SecReT4
Protein ID: 18150982
T4SS name [ID]VirB [383]
Gene symbolmpfJ
Locus tagpWWO_p130
StrainPseudomonas putida plasmid pWW0 (NC_003350)
Repliconplasmid pWW0 [GenBank: NC_003350] [Browse all T4SS(s) in this replicon]
Location [Strand]103168..104115 [-]
Productputative mating pair formation protein
Component typeVirB1
UniProt IDQ8VMF7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam SLT [PF01464], Evalue: 2.5e-13, Aligned region: 44..167
Protein Sequence: 315 a.a.     [Download]
>gi|18150982|ref|NP_542919.1| putative mating pair formation protein [Pseudomonas putida]
MADASSRRFNMRKLPKFTLALLASVCASGIVHAEDAQPTRFSELAAKCAPTVHPSTLKALIGNESTFNPY
AIGVVGTHLQRQPQSLSEAIATAEQLERDGKRYAMGLGQLLVTNMRARGLSYEDVFEPCRNLQAISNLLV
EYYKQALTTSSDKQEALLKAFSMYYSGNELRGFRPDRPGEMSYVEKVVHNALNPTAEDPIVPAVEGAEGA
EPIAVVAASVSARKAPQRARRASEQQEGPWLTFTDDNGQAVAAVKTETASKPQIQVHLNTDAEADVPKRE
FKRFDQPAPQHFEQAEAQPVADQQQATPSFVQIIN
 
Nucleotide Sequence: 948 bp     [Download]
>gi|18150858|ref|NC_003350.1|:c104115-103168 Pseudomonas putida plasmid pWW0, complete sequence
ATGGCCGACGCATCATCACGGAGGTTCAATATGCGAAAGCTGCCTAAGTTCACTCTGGCGCTGCTGGCCA
GCGTCTGCGCGTCTGGCATTGTCCATGCCGAGGATGCCCAACCGACTCGGTTTTCCGAACTTGCCGCCAA
GTGCGCGCCGACCGTTCACCCGTCCACGCTCAAGGCGTTGATCGGTAACGAGTCGACCTTCAACCCTTAC
GCAATCGGCGTGGTCGGCACCCACCTGCAGCGGCAACCGCAGTCCTTGAGCGAAGCCATCGCCACTGCCG
AGCAGTTGGAGCGTGACGGCAAGCGCTACGCAATGGGGCTTGGCCAGCTGTTGGTCACCAACATGCGAGC
CCGTGGCCTGAGTTATGAGGACGTTTTCGAGCCATGCCGCAACCTCCAGGCCATCAGCAATCTGCTGGTC
GAGTATTACAAGCAGGCGCTTACCACCAGCAGCGACAAGCAAGAGGCATTGTTGAAGGCCTTTTCTATGT
ACTACAGCGGCAACGAGCTGCGCGGATTCCGCCCGGATCGGCCGGGTGAAATGTCGTACGTCGAGAAAGT
GGTTCACAACGCCCTGAACCCCACTGCCGAGGATCCGATTGTGCCGGCTGTAGAGGGTGCGGAAGGCGCT
GAGCCGATTGCGGTGGTTGCAGCCAGCGTCTCTGCCCGAAAAGCGCCCCAGCGCGCTCGTAGGGCCTCCG
AGCAGCAGGAAGGCCCATGGCTGACCTTCACTGACGACAATGGCCAGGCCGTTGCTGCCGTCAAGACTGA
GACGGCCAGCAAGCCGCAGATTCAAGTCCACCTCAATACCGATGCCGAGGCCGATGTTCCGAAACGGGAA
TTCAAGCGCTTCGATCAGCCAGCGCCGCAACACTTTGAACAAGCCGAGGCGCAGCCTGTTGCGGACCAGC
AGCAGGCGACCCCGTCATTTGTCCAGATCATCAACTGA
 Primer design