SecReT4
Protein ID: 18150983
T4SS name [ID]VirB [383]
Gene symbolmpfI
Locus tagpWWO_p131
StrainPseudomonas putida plasmid pWW0 (NC_003350)
Repliconplasmid pWW0 [GenBank: NC_003350] [Browse all T4SS(s) in this replicon]
Location [Strand]104069..105100 [-]
Productputative mating pair formation protein
Component typeVirB11
UniProt IDQ8VMF6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.4e-60, Aligned region: 13..323
Protein Sequence: 343 a.a.     [Download]
>gi|18150983|ref|NP_542920.1| putative mating pair formation protein [Pseudomonas putida]
MSEIASFRQKLGPLVGLLDDPEVTEIAINGPDNVFAGYRSSRFMRPVAVQGVTLPLIKSLASLIAAHTNQ
EVSAYTPILSGRIPINLDDNVPENERGDYRVQIVLAPAVEQHIGGIVCIRKPGRKQITLDQYEASGAFDF
INQPRDHGQYSDDHLVELYRAKRWKEFFKGIVKARKNIMVSAGTNAGKTTFLNELLQHVEGNGERIITIE
DTRELRPAGENVVNLIYSRGGQGKARVTPFDHLESILRLTPDRAIMGELRGGEAFPFLELMNTGHSGTMS
SIHADSPDLMFDRLASMASRGGADMSKNQLIEFSRHLIDVVIQWEYGFDGRRIITEVQYAKAA
 
Nucleotide Sequence: 1032 bp     [Download]
>gi|18150858|ref|NC_003350.1|:c105100-104069 Pseudomonas putida plasmid pWW0, complete sequence
ATGTCTGAGATTGCATCATTTCGCCAAAAGCTGGGTCCCCTGGTTGGCCTGCTGGATGACCCGGAAGTGA
CGGAGATCGCTATCAACGGACCAGACAACGTATTTGCCGGCTACCGCAGTAGCCGGTTCATGCGCCCGGT
TGCGGTTCAAGGTGTAACGCTCCCCCTGATCAAGTCCCTGGCCAGCCTGATTGCCGCTCACACCAACCAG
GAAGTAAGCGCCTACACGCCAATCCTGTCGGGGCGTATCCCAATCAATCTGGACGACAACGTGCCGGAAA
ACGAGCGGGGCGACTACCGCGTCCAGATCGTCCTGGCCCCGGCTGTTGAGCAGCACATCGGCGGTATCGT
CTGCATCCGTAAGCCAGGCCGGAAGCAAATTACCCTCGATCAATATGAGGCTTCCGGTGCCTTCGACTTC
ATCAACCAGCCGCGTGACCATGGCCAATACAGCGATGATCACCTGGTTGAGCTGTATAGGGCCAAGCGCT
GGAAAGAGTTCTTCAAGGGCATCGTCAAAGCGCGCAAGAACATCATGGTGTCTGCCGGTACCAACGCCGG
CAAAACCACTTTCCTCAACGAGCTGCTGCAGCATGTGGAGGGCAATGGCGAGCGGATCATCACCATCGAG
GACACCCGCGAACTGCGCCCAGCCGGCGAAAACGTGGTGAACCTGATCTATTCGCGAGGTGGCCAGGGCA
AGGCCCGTGTCACACCATTTGACCACCTGGAATCGATTCTTCGCCTGACCCCTGACCGGGCAATCATGGG
CGAGCTGCGTGGCGGCGAGGCGTTCCCCTTCCTTGAACTGATGAACACCGGCCACAGCGGCACGATGAGT
TCCATCCACGCCGACTCGCCGGATCTCATGTTCGACCGCCTGGCATCCATGGCATCGCGTGGCGGTGCCG
ACATGAGCAAAAACCAGCTGATCGAGTTCTCCCGGCATCTGATCGATGTCGTTATCCAGTGGGAATACGG
CTTCGATGGCCGACGCATCATCACGGAGGTTCAATATGCGAAAGCTGCCTAA
 Primer design