SecReT4
Protein ID: 18150984
T4SS name [ID]VirB [383]
Gene symbolmpfH
Locus tagpWWO_p133
StrainPseudomonas putida plasmid pWW0 (NC_003350)
Repliconplasmid pWW0 [GenBank: NC_003350] [Browse all T4SS(s) in this replicon]
Location [Strand]105110..106375 [-]
Productputative mating pair formation protein
Component typeVirB10
UniProt IDQ8VMF5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.1e-53, Aligned region: 217..401
Protein Sequence: 421 a.a.     [Download]
>gi|18150984|ref|NP_542921.1| putative mating pair formation protein [Pseudomonas putida]
MATDPTQPQEKTRDEELREWNESNSMLKGKAGNNKRSGIAIAIAAVVACGFAYMVTHGDEEAESPDTLKN
EELVAASPRKVMDPPPRREAAKVAPVSNEPGAPADTPRSVVDRQQQQGAGMSDEERRRQQLEMQAELERQ
KMLAARQRSAIFATAKDEGFEQGVGQGEDGQQAGSGSLLGGGRASQGHMNANDAFAASTYSDSVPFTEAR
VMKNLQYKVLQGAVIEATLQPRAQSQLPGQICASIAQDVYAAEGRRVMIPWGSLVCGSYNASLMPGQERL
FTIWNFVRIPRRDGLPPMEIPLNSAGTDQLGTAGQGGVVDNHWAQIFGVAAAVSIIGAGASNSGVSSGDQ
ENSSSRYRSEVQEAAADSAQTILGRYANIQPTVTVPHGSRVVIYLQRDLDFSKVFTKQAERAERGGVTFI
N
 
Nucleotide Sequence: 1266 bp     [Download]
>gi|18150858|ref|NC_003350.1|:c106375-105110 Pseudomonas putida plasmid pWW0, complete sequence
ATGGCCACTGATCCGACCCAACCTCAAGAAAAGACCCGCGACGAAGAACTGCGCGAGTGGAACGAATCCA
ACTCCATGCTCAAGGGCAAGGCAGGGAACAACAAGCGCAGTGGGATCGCGATTGCCATTGCCGCCGTGGT
TGCGTGCGGCTTCGCCTACATGGTCACCCACGGCGATGAGGAAGCAGAAAGCCCGGACACTTTGAAGAAT
GAAGAACTGGTCGCGGCCAGTCCGCGCAAGGTGATGGATCCGCCCCCACGGCGCGAGGCAGCCAAAGTGG
CACCTGTGAGCAACGAGCCAGGCGCGCCGGCTGACACGCCGCGTTCGGTCGTTGACCGGCAGCAGCAACA
AGGTGCCGGCATGAGCGATGAAGAACGCCGCCGCCAGCAGCTGGAAATGCAAGCCGAGCTGGAACGCCAA
AAAATGCTAGCTGCGCGGCAGCGGTCGGCCATTTTTGCCACCGCCAAGGATGAAGGGTTTGAGCAAGGCG
TAGGGCAGGGCGAGGACGGCCAGCAGGCCGGCAGCGGGTCCCTGCTGGGCGGTGGTCGTGCTTCGCAAGG
CCACATGAACGCCAACGATGCGTTCGCCGCATCGACCTACAGCGACAGCGTACCGTTCACCGAGGCCCGT
GTGATGAAGAACCTGCAGTACAAAGTGCTGCAGGGTGCTGTCATCGAAGCGACGTTGCAGCCACGCGCAC
AAAGCCAGCTGCCCGGCCAGATCTGCGCGTCGATTGCGCAGGATGTGTATGCCGCCGAAGGCCGTCGAGT
GATGATCCCGTGGGGATCCTTGGTGTGCGGTAGCTATAACGCCAGCTTGATGCCTGGCCAAGAGCGCCTG
TTCACCATCTGGAACTTCGTTCGCATCCCTCGTAGGGATGGACTGCCACCCATGGAAATTCCGCTTAACA
GCGCAGGCACCGACCAGCTGGGGACCGCTGGCCAGGGTGGTGTGGTCGACAATCACTGGGCTCAAATTTT
CGGGGTCGCGGCGGCGGTATCGATCATCGGTGCCGGTGCTTCCAACTCCGGCGTTTCGTCGGGCGATCAG
GAAAACTCATCGTCGCGCTACCGCAGCGAAGTGCAGGAGGCTGCAGCCGATTCCGCCCAGACCATCCTGG
GCCGCTACGCCAATATCCAGCCGACAGTGACCGTACCGCACGGCTCCCGTGTCGTGATCTACCTGCAGCG
CGACCTGGACTTCTCCAAGGTCTTCACCAAGCAGGCCGAACGCGCCGAACGCGGCGGCGTCACCTTCATC
AACTGA
 Primer design