SecReT4
Protein ID: 18150985
T4SS name [ID]VirB [383]
Gene symbolmpfG
Locus tagpWWO_p134
StrainPseudomonas putida plasmid pWW0 (NC_003350)
Repliconplasmid pWW0 [GenBank: NC_003350] [Browse all T4SS(s) in this replicon]
Location [Strand]106378..107163 [-]
Productputative mating pair formation protein
Component typeVirB9
UniProt IDQ8VMF4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.5e-59, Aligned region: 34..242
Protein Sequence: 261 a.a.     [Download]
>gi|18150985|ref|NP_542922.1| putative mating pair formation protein [Pseudomonas putida]
MKKQYVLPTAIALSLSLCAFSTHAAKLPKALSSDNRVKQVPYDPNQVYELVGTYGYQTSIEFEADEMVKV
VALGDTIAWQSMPFRNRVFLKPVEDNADTNMTVITSKRTYYFQLNSTKAKSGQSYLVRFVYPNARITSYN
PEGETPAGNAPVTSSGTPASPNINYGYAGDKEAIGLQAVMDDGQFTKFLMKKGTDLPQFYRVLPDGTEAM
VDAHREGEYWVVKRLASMFVVRSGNAHICVENLANPYKRTVTRGARDGGGA
 
Nucleotide Sequence: 786 bp     [Download]
>gi|18150858|ref|NC_003350.1|:c107163-106378 Pseudomonas putida plasmid pWW0, complete sequence
ATGAAAAAACAGTATGTTTTGCCGACCGCTATTGCCTTGAGTTTGTCACTCTGTGCATTCAGCACGCATG
CGGCAAAGTTGCCGAAGGCTCTTTCCAGTGATAATCGGGTCAAGCAAGTGCCCTATGATCCGAACCAAGT
TTATGAGTTGGTTGGGACTTACGGCTATCAGACCTCCATCGAATTCGAAGCCGATGAAATGGTCAAGGTC
GTGGCGCTGGGCGACACCATCGCCTGGCAGAGCATGCCCTTCCGCAACCGTGTGTTCCTCAAGCCGGTTG
AAGATAACGCCGACACTAACATGACGGTGATCACCTCCAAGCGTACCTACTATTTCCAGTTGAACAGCAC
CAAGGCCAAGTCGGGTCAGTCGTACCTTGTCCGCTTCGTCTACCCGAACGCACGCATCACCTCGTATAAC
CCCGAAGGTGAAACGCCTGCCGGCAATGCCCCCGTCACCAGCTCGGGCACGCCGGCATCGCCAAACATCA
ACTACGGCTATGCGGGTGACAAGGAAGCCATCGGCCTGCAGGCGGTAATGGATGACGGCCAGTTCACCAA
GTTCTTGATGAAGAAAGGCACGGACCTGCCGCAGTTCTACCGCGTGCTGCCCGATGGCACCGAGGCCATG
GTCGATGCTCACCGGGAAGGTGAGTATTGGGTCGTCAAGCGCCTGGCCAGCATGTTCGTCGTGCGCAGCG
GCAATGCCCATATCTGCGTCGAGAACCTGGCCAATCCCTACAAGCGCACCGTTACCCGTGGTGCCCGTGA
CGGCGGGGGGGCATAA
 Primer design