SecReT4
Protein ID: 18150986
T4SS name [ID]VirB [383]
Gene symbolmpfF
Locus tagpWWO_p136
StrainPseudomonas putida plasmid pWW0 (NC_003350)
Repliconplasmid pWW0 [GenBank: NC_003350] [Browse all T4SS(s) in this replicon]
Location [Strand]107189..107869 [-]
Productputative mating pair formation protein
Component typeVirB8
UniProt IDQ8VMF3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.8e-42, Aligned region: 15..222
Protein Sequence: 226 a.a.     [Download]
>gi|18150986|ref|NP_542923.1| putative mating pair formation protein [Pseudomonas putida]
MEYVDNGQRFQQAEKARRKREVEGNKTRQERNRSLFFQGVQAAAILGLGFAVASLANSKTYIPVVTVLGA
DGEVLKQRVITNDNVDQEQAIIEKVMFDMIRACETFDPKRKQQLSDTCHTYQIQQVAREYEELISPENLQ
NPYVTLGENDWIEAQPYRMNKVGDEYQVAFKAITHKWGDKEPTERRYLSTVKVAHTLVPRALGDRWENPF
GTLATVYRKSEELSRQ
 
Nucleotide Sequence: 681 bp     [Download]
>gi|18150858|ref|NC_003350.1|:c107869-107189 Pseudomonas putida plasmid pWW0, complete sequence
TTGGAGTACGTCGATAATGGACAAAGATTTCAACAGGCCGAGAAAGCACGCCGCAAGCGTGAAGTCGAAG
GCAACAAAACCCGCCAAGAGCGCAACCGGTCGCTGTTCTTCCAGGGTGTTCAGGCAGCTGCAATCCTCGG
CCTTGGCTTCGCCGTGGCCAGCCTGGCCAACTCGAAGACTTACATCCCGGTCGTGACGGTGCTGGGGGCT
GACGGGGAGGTTCTGAAACAGCGGGTTATCACCAACGATAACGTAGACCAGGAGCAGGCGATCATCGAAA
AAGTCATGTTCGACATGATCCGCGCCTGCGAGACGTTTGATCCCAAGCGTAAACAGCAGCTGTCTGATAC
CTGCCACACCTATCAGATCCAACAAGTTGCTCGGGAATATGAAGAACTTATCAGCCCGGAAAACTTGCAG
AACCCCTATGTGACGCTCGGCGAAAATGATTGGATTGAAGCCCAGCCATATCGGATGAACAAGGTAGGCG
ATGAATATCAAGTCGCGTTCAAAGCGATAACGCACAAGTGGGGTGACAAGGAACCTACCGAGCGCCGTTA
TCTCTCGACGGTCAAGGTAGCCCATACCTTGGTGCCCCGCGCTCTTGGGGATCGATGGGAAAACCCATTT
GGTACTCTCGCGACTGTATATCGCAAAAGCGAAGAACTGAGCCGCCAGTAA
 Primer design