SecReT4
Protein ID: 18150987
T4SS name [ID]VirB [383]
Gene symbolmpfE
Locus tagpWWO_p137
StrainPseudomonas putida plasmid pWW0 (NC_003350)
Repliconplasmid pWW0 [GenBank: NC_003350] [Browse all T4SS(s) in this replicon]
Location [Strand]107853..108716 [-]
Productputative mating pair formation protein
Component typeVirB6
UniProt IDQ8VMF2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.9e-36, Aligned region: 41..264
Protein Sequence: 287 a.a.     [Download]
>gi|18150987|ref|NP_542924.1| putative mating pair formation protein [Pseudomonas putida]
MAQLTLQGLVGATDEVTTAFVSQVFPNLASMVEPLVWTLAVGYWVALGLQMYNGHVAVKSWDIVKRAMLT
ALVFTCLNWSKGGTILYQAWGGWTEGIAAKIMSGGVSTNSMLDALYVDIGKVASTLMNVSWRQVAMIMMG
TGLFVLNCILFIAAVLNMLIAKFGAAIIMAIMPVLIGFIFFDAVRQWAMNWFSKMLNFSLIYILSIAVVR
FGYSVFGDAIKEVAATATITDAALITAQQWGQLVIVEGVMIICMLQVRGWAAALSSGATVGGSSLVLMAL
RSIGVRR
 
Nucleotide Sequence: 864 bp     [Download]
>gi|18150858|ref|NC_003350.1|:c108716-107853 Pseudomonas putida plasmid pWW0, complete sequence
ATGGCGCAGCTGACGTTACAAGGCCTGGTTGGAGCGACTGACGAAGTAACCACCGCGTTCGTAAGTCAAG
TCTTCCCCAATCTGGCCAGCATGGTTGAACCGCTAGTTTGGACTTTGGCGGTCGGCTATTGGGTCGCCTT
GGGCCTGCAGATGTACAACGGGCATGTGGCGGTGAAAAGCTGGGATATCGTCAAGCGAGCCATGTTGACC
GCCCTGGTGTTCACCTGTCTGAACTGGTCGAAGGGCGGGACGATCCTGTATCAAGCCTGGGGTGGTTGGA
CCGAAGGTATCGCGGCAAAGATCATGAGTGGCGGTGTAAGCACCAACTCCATGCTCGACGCGTTGTACGT
AGATATCGGTAAAGTGGCCAGTACGCTGATGAATGTGAGCTGGCGGCAAGTAGCGATGATCATGATGGGT
ACCGGTTTGTTTGTACTGAACTGCATCCTGTTCATCGCAGCGGTCCTTAACATGCTGATCGCCAAGTTTG
GCGCCGCGATCATCATGGCGATCATGCCGGTATTGATTGGTTTCATTTTCTTTGACGCGGTACGACAGTG
GGCAATGAACTGGTTTAGCAAGATGCTCAACTTCTCATTGATCTACATCCTTTCAATTGCGGTCGTTCGA
TTCGGGTATTCCGTATTCGGTGACGCAATCAAGGAAGTTGCCGCAACGGCGACAATTACCGATGCAGCCC
TGATTACTGCCCAGCAGTGGGGCCAGCTGGTTATTGTCGAGGGTGTAATGATCATCTGCATGCTGCAGGT
GCGCGGTTGGGCTGCGGCCTTGTCATCCGGTGCGACTGTAGGCGGATCCTCGCTGGTACTGATGGCGCTG
CGTTCGATTGGAGTACGTCGATAA
 Primer design