SecReT4
Protein ID: 18150990
T4SS name [ID]VirB [383]
Gene symbolmpfD
Locus tagpWWO_p141
StrainPseudomonas putida plasmid pWW0 (NC_003350)
Repliconplasmid pWW0 [GenBank: NC_003350] [Browse all T4SS(s) in this replicon]
Location [Strand]109330..110019 [-]
Productputative mating pair formation protein
Component typeVirB5
UniProt IDQ8VME9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 6.8e-46, Aligned region: 25..216
Protein Sequence: 229 a.a.     [Download]
>gi|18150990|ref|NP_542927.1| putative mating pair formation protein [Pseudomonas putida]
MTTIKKLGLAVAMSMAIGSQAIASGVPTGDAGTWAGLSQNLMQLKEQYKTLKDQYEAQTNILNNLQGSYG
RGAIGLNESINSASVVPGSWQEVVSRQNSGAYGSKQSYYEQLINTLPQELFAAPDSNRAKDYQLSSNSVV
AALSAGDALYSEVQVHLNNLATLSSQVDLTTNAKDAADLQNRIATENGMLTSAQSKLQALNMNLQANLAN
QENQATAQNEQFFRWKDEN
 
Nucleotide Sequence: 690 bp     [Download]
>gi|18150858|ref|NC_003350.1|:c110019-109330 Pseudomonas putida plasmid pWW0, complete sequence
ATGACAACTATTAAGAAACTCGGTTTGGCGGTCGCTATGTCGATGGCTATTGGGAGCCAGGCCATTGCCT
CTGGAGTACCAACGGGTGACGCCGGTACCTGGGCAGGCCTCTCGCAGAATCTCATGCAACTCAAAGAGCA
GTACAAAACGCTCAAAGATCAGTATGAGGCGCAGACCAACATTCTGAACAACCTGCAGGGTAGCTATGGC
CGTGGCGCCATAGGCTTGAACGAGTCCATTAACTCGGCATCGGTCGTCCCCGGCTCCTGGCAGGAAGTGG
TTTCCCGGCAAAACTCGGGGGCCTACGGCAGCAAGCAGAGCTATTACGAGCAGCTGATCAACACCCTGCC
GCAAGAGCTGTTCGCCGCACCTGACAGCAACCGCGCAAAGGACTACCAGCTCAGTTCCAACTCGGTCGTG
GCGGCTCTCTCCGCTGGCGATGCGCTGTACAGCGAAGTGCAGGTCCACCTGAATAACCTGGCCACGTTGT
CGTCGCAAGTCGATCTCACAACGAACGCCAAGGATGCTGCCGACCTGCAGAACCGCATCGCCACTGAGAA
CGGCATGTTGACCTCGGCCCAGTCGAAGCTGCAGGCCCTGAACATGAACCTGCAGGCGAACCTGGCCAAC
CAGGAAAACCAAGCGACAGCGCAGAACGAGCAGTTCTTCCGCTGGAAAGATGAAAACTGA
 Primer design