SecReT4
Protein ID: 18150991
T4SS name [ID]VirB [383]
Gene symbolmpfC
Locus tagpWWO_p142
StrainPseudomonas putida plasmid pWW0 (NC_003350)
Repliconplasmid pWW0 [GenBank: NC_003350] [Browse all T4SS(s) in this replicon]
Location [Strand]110019..112703 [-]
Productputative mating pair formation protein
Component typeVirB4
UniProt IDQ8VME8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 1.8e-20, Aligned region: 258..460
AAA_10 [PF12846], Evalue: 1.4e-14, Aligned region: 525..795
Protein Sequence: 894 a.a.     [Download]
>gi|18150991|ref|NP_542928.1| putative mating pair formation protein [Pseudomonas putida]
MRLVDKAFKKLTRNMDLSLGVQHPEAAALDDDEMLVSAMVPYDVHYDDETVVTSEEALVQVIKVDGLLFD
SLSAEQIKRFEQQRNTVFRTIASSDLTVYVTFVRRKVTDFPDGMGGTWFSQQFNKRLRARYESRGFYIND
IYISLVRRRFRAGMPGLMDRAIAMLTGTEATKNEAESLDAMADSLYKASNLVLRSLADYGTRRLRVQRLP
EPRMGRIDRETAFDAVKRFQLQWHDFKANVGDHEIYPADLVHDFLGEEFCELSSFFNYLINLEDRKVPVS
DLLIRESLPYARLNFRVLANMCEIRGSTESKIGAMLSMGEWPRRTPSRMLDKFLQQPVEFIITQSFTFQN
RIEAEQGMLDETRRMTVDDKHNISEDDQKELKQGISDLRRGNAVNGAHHLTIFVHVPSLPMTTEANREIN
RKRLDHAVGLVEGCFVEMLVKPVREWFALETFFWSQLPGQKEALIGRRGKIKSSNFAGFASLHNYARGRR
DGNLWGPAITAFETESFTQYNFNFHREMEGMVAGHLGMAADTGMGKTTLLTLLISEADKALPLVFWFDNR
FGAKVFMKAMGGVHTTLSPHSNMRWNPLKLPDTPENRAYLVDWQVQMRECYASTPTSAEDITRFKAAVEE
NYGLPLADRRLRNVVWTYGQGDLADVMAIWHGAKGVIGANAGVFDNAEDSIDFTQARHYCFEMMELLKGG
EARPELPVVMSYPLHRIEQAMNGRPFILVLEEGQNLVKNEFWRKKIDNFIMQIRRKNGLIIFVTPDAKYF
RSETDSIDKQTVTKIYLASDQVKDEDHENLTVAEREWLRKLNPKEHKFLIRRGRESVRACFDLSSDNPDE
DLSDFIPVLSSNDVGVALMDQIIERLGTDDPAVWVPVFMQEAKAKNTHNLKAVR
 
Nucleotide Sequence: 2685 bp     [Download]
>gi|18150858|ref|NC_003350.1|:c112703-110019 Pseudomonas putida plasmid pWW0, complete sequence
ATGCGCCTCGTTGATAAAGCATTCAAAAAACTGACGCGAAACATGGATCTTTCGCTCGGTGTTCAGCATC
CCGAGGCTGCGGCGTTGGATGATGATGAAATGCTGGTGAGCGCCATGGTGCCTTACGACGTTCATTACGA
TGACGAAACCGTTGTCACCAGCGAGGAAGCGCTGGTGCAGGTCATCAAGGTGGACGGCCTCTTGTTCGAC
TCGCTTTCAGCCGAGCAGATCAAGCGCTTCGAGCAGCAGCGCAACACCGTGTTCCGCACCATCGCAAGCA
GTGACCTGACCGTATATGTCACGTTCGTACGCCGCAAGGTGACCGATTTTCCAGACGGCATGGGTGGAAC
TTGGTTCTCCCAGCAGTTCAACAAGCGGCTGCGCGCCCGCTATGAAAGCCGTGGGTTCTACATCAACGAT
ATCTACATTTCGCTGGTGAGAAGGCGCTTTCGGGCTGGCATGCCTGGCTTGATGGACCGCGCCATCGCGA
TGCTGACCGGGACCGAGGCCACCAAGAACGAAGCCGAATCACTCGATGCAATGGCTGACTCGCTTTACAA
GGCATCTAATCTGGTGCTGCGTAGCCTAGCTGATTACGGCACGCGCCGTCTGCGTGTTCAACGTCTGCCT
GAGCCGCGCATGGGCAGGATTGACCGTGAAACGGCTTTCGACGCGGTGAAACGCTTCCAGCTCCAATGGC
ACGATTTCAAGGCGAACGTTGGTGACCATGAGATCTATCCCGCCGACCTGGTACATGACTTCCTGGGTGA
GGAATTCTGCGAACTGAGCAGCTTCTTCAACTACCTGATCAACCTTGAGGATCGAAAGGTGCCGGTGTCG
GACCTGCTGATCCGCGAATCGCTGCCATACGCACGGCTGAATTTCCGCGTACTGGCCAATATGTGCGAGA
TCCGTGGCAGCACCGAGTCGAAAATTGGCGCGATGCTGAGCATGGGGGAGTGGCCTCGCCGTACGCCGTC
GCGGATGCTCGACAAGTTCCTGCAGCAGCCGGTGGAGTTCATCATCACCCAGTCGTTCACGTTCCAGAAC
CGGATCGAGGCCGAGCAGGGAATGCTGGATGAAACCCGCCGCATGACCGTTGACGACAAGCACAACATTT
CCGAGGACGACCAGAAGGAACTGAAACAAGGGATCAGCGACCTGCGCCGTGGCAATGCGGTCAATGGCGC
GCATCACCTGACCATTTTCGTGCATGTGCCATCGCTGCCGATGACTACCGAGGCAAACCGGGAGATCAAC
CGCAAGCGCCTGGATCATGCGGTTGGTCTGGTGGAAGGTTGCTTCGTTGAAATGCTGGTCAAACCAGTGC
GTGAATGGTTCGCCCTGGAAACCTTCTTCTGGTCGCAACTGCCGGGCCAGAAAGAAGCGCTGATCGGTCG
ACGCGGCAAGATCAAGTCCAGCAACTTCGCCGGCTTTGCGTCCTTGCACAACTACGCCCGGGGCCGTCGT
GACGGCAACCTGTGGGGGCCTGCGATCACCGCCTTTGAGACGGAGAGCTTCACGCAATACAACTTCAATT
TTCACCGTGAAATGGAAGGCATGGTAGCGGGCCACTTGGGCATGGCGGCTGATACCGGCATGGGTAAAAC
CACGCTGCTGACCCTGCTGATTTCCGAGGCAGACAAGGCTCTACCGCTGGTGTTCTGGTTCGATAACCGC
TTTGGGGCCAAGGTATTCATGAAGGCTATGGGCGGCGTTCACACCACGCTCTCCCCGCACAGCAACATGC
GCTGGAACCCGCTCAAGCTGCCTGACACGCCGGAAAACCGTGCGTACCTGGTGGACTGGCAAGTGCAGAT
GCGCGAGTGCTACGCCTCGACGCCGACCAGTGCCGAAGACATTACCCGCTTCAAGGCAGCGGTGGAGGAG
AACTATGGTCTGCCCCTCGCTGATCGCCGTCTGCGCAATGTGGTCTGGACCTACGGGCAGGGCGATCTAG
CCGACGTTATGGCCATCTGGCATGGCGCCAAAGGCGTCATCGGCGCGAATGCCGGTGTGTTCGACAATGC
GGAGGATTCCATCGACTTTACCCAGGCGCGGCACTACTGCTTTGAAATGATGGAACTGCTCAAGGGTGGC
GAAGCCCGTCCAGAGCTGCCCGTCGTGATGAGCTACCCGCTGCATCGGATCGAGCAGGCCATGAATGGTC
GCCCCTTCATTTTGGTATTGGAAGAAGGCCAGAACCTGGTCAAGAACGAGTTTTGGCGCAAGAAGATCGA
CAACTTCATCATGCAGATCCGCCGTAAGAACGGCCTGATTATCTTCGTGACGCCGGATGCCAAGTATTTC
CGCAGCGAAACGGATTCCATCGATAAGCAGACCGTCACCAAGATCTACCTGGCCAGCGACCAGGTGAAAG
ATGAAGACCATGAAAACCTGACGGTGGCCGAGCGGGAATGGCTGCGCAAGCTCAACCCGAAAGAACACAA
GTTCCTGATCCGTCGTGGCCGGGAATCGGTGCGGGCCTGCTTCGATCTCTCGTCGGATAACCCTGATGAG
GACCTGTCCGACTTTATCCCGGTCCTGTCCTCGAATGACGTTGGTGTCGCCCTGATGGATCAGATCATCG
AGCGCCTTGGCACTGACGATCCAGCGGTCTGGGTGCCTGTATTCATGCAGGAAGCCAAGGCTAAAAACAC
CCATAACTTGAAGGCGGTTCGATGA
 Primer design