SecReT4
Protein ID: 18150992
T4SS name [ID]VirB [383]
Gene symbolmpfB
Locus tagpWWO_p143
StrainPseudomonas putida plasmid pWW0 (NC_003350)
Repliconplasmid pWW0 [GenBank: NC_003350] [Browse all T4SS(s) in this replicon]
Location [Strand]112690..112986 [-]
Productputative mating pair formation protein
Component typeVirB3
UniProt IDQ7AXT8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 2.8e-17, Aligned region: 1..93
Protein Sequence: 98 a.a.     [Download]
>gi|18150992|ref|NP_542929.1| putative mating pair formation protein [Pseudomonas putida]
MAEYDDLEEGEVLVLAMARPSMVGPFTLSSILISLIAPVLLALLIRSLYPLGLIPVLFVISYWICSKDVY
LFGVLQAASNLKASRLRKLWGYRSYAPR
 
Nucleotide Sequence: 297 bp     [Download]
>gi|18150858|ref|NC_003350.1|:c112986-112690 Pseudomonas putida plasmid pWW0, complete sequence
ATGGCCGAGTACGACGACCTTGAAGAAGGTGAAGTGCTCGTATTGGCAATGGCCCGACCTTCCATGGTCG
GACCATTCACACTGTCGAGCATTCTTATAAGTCTGATAGCACCCGTGCTGTTAGCACTGTTGATTCGATC
ACTGTACCCGTTGGGGCTTATCCCAGTGTTGTTTGTCATTTCGTATTGGATATGCAGTAAAGACGTATAT
CTGTTCGGTGTGTTACAGGCAGCAAGTAATCTGAAAGCATCACGGTTACGCAAACTTTGGGGGTATCGCA
GTTATGCGCCTCGTTGA
 Primer design