SecReT4
Protein ID: 18150993
T4SS name [ID]VirB [383]
Gene symbolmpfA
Locus tagpWWO_p145
StrainPseudomonas putida plasmid pWW0 (NC_003350)
Repliconplasmid pWW0 [GenBank: NC_003350] [Browse all T4SS(s) in this replicon]
Location [Strand]112995..113456 [-]
Productputative mating pair formation protein
Component typeVirB2
UniProt IDQ8VME7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.6e-17, Aligned region: 49..144
Protein Sequence: 153 a.a.     [Download]
>gi|18150993|ref|NP_542930.1| putative mating pair formation protein [Pseudomonas putida]
MQLSARNSGQNVGTNDKQTWRTWLKDKANATLKQVLSQKTPSHKAMMRDDWMAKATKFAVLGSFISFAIL
PEIANAAMDFSGLKNLAKDVVSFLIFDIGYYLGIAAIAFCGFQAKSGRMSWGQFGWAVAGVFLVFFSPNL
VDTIKTGAQTALK
 
Nucleotide Sequence: 462 bp     [Download]
>gi|18150858|ref|NC_003350.1|:c113456-112995 Pseudomonas putida plasmid pWW0, complete sequence
ATGCAACTCTCTGCTCGCAACTCTGGACAAAACGTAGGTACTAACGACAAACAAACCTGGCGCACTTGGC
TCAAGGACAAAGCCAACGCAACTTTGAAACAAGTTCTCTCGCAAAAGACTCCATCGCACAAAGCAATGAT
GCGCGATGACTGGATGGCCAAGGCCACCAAATTCGCAGTGTTGGGGTCGTTCATTTCCTTCGCAATTCTC
CCTGAAATTGCCAATGCGGCAATGGATTTCAGCGGCCTGAAAAACCTGGCCAAGGACGTCGTGTCCTTCC
TCATCTTCGATATCGGCTACTACCTGGGCATCGCAGCCATCGCATTCTGCGGCTTCCAGGCCAAGTCGGG
CCGTATGTCGTGGGGGCAATTCGGCTGGGCCGTCGCTGGTGTGTTCCTGGTGTTCTTCTCGCCCAACCTG
GTCGATACCATCAAAACCGGTGCGCAAACCGCACTGAAGTGA
 Primer design