SecReT4
Protein ID: 182682735
T4SS name [ID]Trb [59]
Gene symbol-
Locus tagXfasM23_2227
StrainXylella fastidiosa M23
Repliconplasmid pXFAS01 [GenBank: NC_010579] [Browse all T4SS(s) in this replicon]
Location [Strand]3..323 [+]
Productconjugal transfer protein TrbD
Component typeTrbD
UniProt IDB2IAS1
KEGG IDxfn:XfasM23_2227
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 8.1e-27, Aligned region: 1..87
Protein Sequence: 106 a.a.     [Download]
>gi|182682735|ref|YP_001830933.1| conjugal transfer protein TrbD [Xylella fastidiosa M23]
MALRTIPIRRAGNRDNLFMGGDREMVMFSGLLCAVLIFVAQDWIAAGFGLGMWFIALWLLRKIAKADPRM
RFVYMRNRRYKAYYPPRATPFRNNTVFQGSQYKCFK
 
Nucleotide Sequence: 321 bp     [Download]
>gi|182682734|ref|NC_010579.1|:3-323 Xylella fastidiosa M23 plasmid pXFAS01, complete sequence
ATGGCACTACGTACTATCCCTATTCGTAGGGCTGGAAACAGAGACAACCTTTTCATGGGTGGGGATCGTG
AAATGGTCATGTTCTCTGGTTTGCTGTGTGCGGTTCTCATTTTTGTGGCGCAAGACTGGATTGCAGCAGG
ATTTGGCCTTGGCATGTGGTTCATTGCCCTTTGGCTTTTAAGAAAGATCGCCAAAGCTGACCCTCGGATG
CGTTTTGTCTACATGCGTAATCGACGTTACAAGGCTTATTACCCGCCACGTGCGACGCCGTTCCGCAACA
ACACGGTTTTCCAAGGGAGCCAATACAAATGTTTCAAATAA
 Primer design