SecReT4
Protein ID: 182682736
T4SS name [ID]Trb [59]
Gene symbol-
Locus tagXfasM23_2228
StrainXylella fastidiosa M23
Repliconplasmid pXFAS01 [GenBank: NC_010579] [Browse all T4SS(s) in this replicon]
Location [Strand]311..2875 [+]
Productconjugal transfer protein TrbE
Component typeTrbE
UniProt IDB2IAS2
KEGG IDxfn:XfasM23_2228
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 3.2e-49, Aligned region: 223..431
AAA_10 [PF12846], Evalue: 5e-31, Aligned region: 489..763
Protein Sequence: 854 a.a.     [Download]
>gi|182682736|ref|YP_001830934.1| conjugal transfer protein TrbE [Xylella fastidiosa M23]
MFQIITIAIALLGTVLLIWLFLLVQRANADLRLKNHRSKDAGLADLLNYAAVVDDGVIVGKNGSFMASWL
YRGADNASATEAERELISFRINQALASFDNAWMVHVDAVRRPAPSYSDPSLSHFPDAVSAAVDEERRRLF
ESIDTLYEGFFVVTVTWFPPVLAERRFVELMFHDDAEKPNDKTRTAHLIDHFKREVINLENRLSLAVELE
RLRGVKITKEDGSTVTHDQQLQWLHFCVTGLNHPIQLPSNPMYIDSLIGGQELYPGVVPKIGRNFIQVVA
IEGFPLESYPGILSVLAELPIEYRWSSRFIFLDHHEAVSHLEKFRKKWKQKMRGFFDQVFNTNTSHVDED
AVSMVADASSAIAETNSGLVSQGYYTSVVVLMNESREQVEQSARRLEKAINALAFTARVETINTMDAYLG
SLPGHGVENVRRPLLNTMNFADLLPTSTIWTGENRAPSPLFPPNAPPLLHGVTSGNSPMRINLHVRDLGH
CIIFGPTRTGKSTKLALVAFQWRRYLGARIYAFDKGLSMYPTCKAMHGHHFSIASNTDKLAFAPLSRLDT
RTRRAWAMEWIDTILALNGVITSPAQRNAIAEAILSMSKSKASTLSEFIVTVQDEVIREALKPYTVDGNM
GYLLDAVEDGLELADFMTFEIEQLMGLGEKFALPVLLYLFMRIEESLSEEDARPTLLILDEAWLMLSHTT
FRDKIEEWLRSMAKKNCSVLMATQSISEAAKSGILDIITESTACRIFLANPNAREEKTAEIYGRLGLNNR
QIEIIASAVPKRDYYYVSEKGRRLYQLALGPLALAFVGSTDKESIAMIRKLEALHGDAWVHEWLRLKGLR
LDEYVSPNDYGVAA
 
Nucleotide Sequence: 2565 bp     [Download]
>gi|182682734|ref|NC_010579.1|:311-2875 Xylella fastidiosa M23 plasmid pXFAS01, complete sequence
ATGTTTCAAATAATCACCATTGCAATCGCATTGCTTGGTACGGTGCTGCTCATCTGGTTGTTCTTGCTTG
TGCAGCGTGCCAATGCCGATTTGCGGCTGAAAAATCATCGTTCCAAGGATGCTGGACTTGCTGATCTTCT
CAATTATGCCGCTGTCGTGGATGATGGCGTAATCGTTGGCAAGAACGGCTCGTTCATGGCGTCGTGGTTG
TACCGCGGTGCTGATAACGCCAGTGCTACGGAAGCTGAGCGGGAGCTTATCTCCTTTCGTATCAACCAAG
CGCTTGCATCATTTGACAATGCTTGGATGGTTCACGTCGATGCAGTGCGCCGACCCGCTCCAAGTTACAG
CGATCCAAGTCTTTCTCATTTTCCTGATGCGGTTTCGGCAGCAGTCGATGAGGAGCGTAGACGATTGTTC
GAGAGCATAGACACGTTGTACGAAGGATTCTTCGTAGTCACGGTCACGTGGTTTCCCCCTGTGTTGGCCG
AACGCAGATTTGTGGAACTCATGTTCCATGATGATGCTGAAAAGCCCAACGATAAGACGCGCACCGCACA
CCTTATCGACCACTTCAAGCGGGAGGTGATTAATCTCGAAAACAGACTTTCCTTGGCTGTTGAGCTTGAA
CGTTTGCGAGGCGTAAAAATAACTAAGGAAGATGGTTCGACTGTAACGCACGATCAGCAATTGCAGTGGC
TCCACTTCTGTGTAACTGGCCTGAATCATCCGATACAGCTCCCAAGCAACCCTATGTACATTGACTCGCT
CATCGGCGGGCAAGAGCTATACCCTGGTGTTGTCCCAAAAATCGGTCGCAATTTCATCCAGGTTGTCGCT
ATCGAAGGGTTTCCCTTGGAGTCATATCCAGGAATCTTATCGGTATTGGCCGAATTGCCTATCGAATATC
GGTGGTCTTCTCGGTTCATTTTTCTTGATCATCACGAGGCTGTGTCTCATCTCGAGAAATTCCGTAAAAA
GTGGAAGCAGAAAATGCGTGGTTTCTTCGACCAGGTATTCAATACGAATACCAGTCACGTCGATGAAGAC
GCGGTTTCGATGGTGGCCGATGCCTCATCAGCGATTGCTGAAACGAACAGTGGCCTGGTTTCGCAAGGCT
ACTACACCAGTGTTGTCGTACTGATGAATGAAAGTCGCGAGCAAGTAGAACAGTCGGCTCGACGACTTGA
AAAGGCAATCAACGCCTTGGCATTTACTGCGCGTGTCGAAACGATCAACACGATGGACGCCTATCTTGGC
TCTCTTCCAGGGCATGGTGTTGAGAACGTGCGTCGTCCTTTGTTGAATACGATGAATTTTGCCGATCTGC
TGCCGACCAGTACGATTTGGACAGGTGAAAATCGTGCACCATCACCGCTTTTCCCTCCTAACGCTCCGCC
CTTGCTGCATGGCGTGACGAGTGGAAACTCTCCTATGCGTATCAATTTGCATGTGCGTGATCTTGGCCAT
TGCATTATTTTCGGCCCAACCAGGACGGGAAAATCGACCAAGCTGGCTTTGGTGGCATTCCAGTGGCGTC
GTTATCTAGGTGCACGCATCTACGCTTTCGACAAGGGTTTGTCGATGTATCCGACATGTAAAGCCATGCA
TGGTCATCATTTCAGTATTGCATCGAACACTGACAAGCTTGCGTTTGCGCCATTGTCGCGACTTGATACT
CGCACCCGCCGCGCATGGGCAATGGAATGGATTGATACGATCCTTGCCTTGAATGGTGTGATTACAAGTC
CTGCACAGCGCAACGCGATTGCCGAAGCGATCCTCAGTATGAGTAAGAGTAAAGCATCCACGTTGTCAGA
GTTTATTGTGACCGTGCAGGACGAAGTGATCCGCGAAGCTCTCAAGCCGTACACCGTGGACGGCAACATG
GGATACCTTCTCGACGCAGTGGAAGATGGCCTTGAACTGGCCGACTTCATGACATTTGAGATTGAACAGT
TGATGGGTCTTGGCGAGAAGTTTGCTCTGCCTGTTCTGCTGTACCTGTTCATGCGGATCGAAGAATCATT
GAGTGAGGAAGATGCACGACCCACACTGCTGATTCTTGATGAGGCTTGGCTGATGCTTTCTCACACAACA
TTCCGCGACAAGATCGAGGAATGGCTGCGCTCAATGGCGAAGAAGAATTGCTCGGTACTCATGGCAACGC
AGAGCATTTCCGAGGCTGCAAAGTCCGGCATTTTGGACATCATCACGGAATCGACCGCCTGCCGGATATT
CCTGGCCAACCCGAATGCGCGTGAGGAAAAGACTGCCGAGATTTACGGTCGCCTTGGCTTAAACAATCGT
CAGATTGAAATCATCGCATCAGCCGTGCCGAAACGTGACTACTACTATGTCTCTGAAAAGGGGCGTCGCC
TGTACCAGCTTGCGCTTGGACCCCTTGCTCTGGCTTTCGTGGGGTCTACCGATAAGGAGTCTATCGCAAT
GATCAGGAAGCTCGAAGCGCTGCACGGTGATGCCTGGGTACATGAGTGGCTGCGCCTTAAGGGTCTGCGC
CTTGATGAATACGTGAGTCCCAATGACTATGGAGTAGCAGCATGA
 Primer design