SecReT4
Protein ID: 182682737
T4SS name [ID]Trb [59]
Gene symbol-
Locus tagXfasM23_2229
StrainXylella fastidiosa M23
Repliconplasmid pXFAS01 [GenBank: NC_010579] [Browse all T4SS(s) in this replicon]
Location [Strand]2872..3588 [+]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDB2IAS3
KEGG IDxfn:XfasM23_2229
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2.7e-43, Aligned region: 26..237
Protein Sequence: 238 a.a.     [Download]
>gi|182682737|ref|YP_001830935.1| conjugal transfer protein TrbF [Xylella fastidiosa M23]
MSVNLRNPFGKKEKPDTNTVNPYLNARRSWNSHVGQIMQHSQVGIFVGLLGMLIGLAAVGGMTYIGSQSK
FIPLVFQQDGSGNTISMTRPDRIPEALVDDYRTAVSDFITNIRLVTPDSGLQNKAVLKAYGYLVPNDPAT
LKANEYLNATKETNPFTRAANEMVSVDVKSVLQQSKDTWQIDWQETVRGRDGSLKGAPYMMRALVTIYQN
KDTEVESEKMFINPHFIFVKDYNWSKQL
 
Nucleotide Sequence: 717 bp     [Download]
>gi|182682734|ref|NC_010579.1|:2872-3588 Xylella fastidiosa M23 plasmid pXFAS01, complete sequence
ATGAGTGTCAATCTAAGAAATCCTTTCGGGAAGAAGGAAAAGCCAGACACCAACACGGTGAATCCTTATC
TCAATGCTCGACGTTCGTGGAACAGTCACGTTGGCCAAATAATGCAACATAGCCAGGTAGGTATCTTCGT
CGGCTTGCTTGGTATGTTGATCGGTCTTGCTGCTGTCGGTGGTATGACCTACATCGGAAGTCAATCGAAA
TTTATTCCATTGGTGTTCCAGCAGGACGGTAGCGGCAACACCATTTCGATGACACGTCCTGATCGCATTC
CCGAGGCTCTGGTAGACGATTATCGCACTGCCGTTTCCGACTTCATTACGAATATTCGTCTCGTAACGCC
AGATTCCGGGTTGCAGAACAAAGCTGTGCTGAAAGCGTATGGCTATCTCGTACCCAACGATCCGGCGACG
CTCAAAGCAAACGAATATCTGAACGCTACGAAAGAAACTAATCCGTTCACTCGCGCTGCGAATGAAATGG
TGAGTGTCGATGTGAAATCTGTTCTCCAGCAGTCTAAAGACACTTGGCAAATTGACTGGCAGGAAACAGT
GCGGGGGCGTGACGGTTCTCTCAAGGGAGCACCGTACATGATGCGTGCGCTCGTGACGATTTATCAAAAC
AAGGATACGGAAGTGGAGTCGGAGAAGATGTTCATCAACCCGCATTTCATTTTCGTCAAAGACTACAACT
GGTCGAAGCAACTTTGA
 Primer design