SecReT4
Protein ID: 182682738
T4SS name [ID]Trb [59]
Gene symbol-
Locus tagXfasM23_2230
StrainXylella fastidiosa M23
Repliconplasmid pXFAS01 [GenBank: NC_010579] [Browse all T4SS(s) in this replicon]
Location [Strand]3605..4495 [+]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDB2IAS4
KEGG IDxfn:XfasM23_2230
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.2e-58, Aligned region: 71..294
Protein Sequence: 296 a.a.     [Download]
>gi|182682738|ref|YP_001830936.1| conjugal transfer protein TrbG [Xylella fastidiosa M23]
MQKTLISALILGLVPMVTFAAPGTDPLADQYFSKNEPKLTTQEKAAVAIGKKWQESQDLKPFQGSDGSIN
WPYLPGKQYPIMCAVLQVCDIALQPGENVNGTNIGDPRYHVEPAVTGSGASQIIHLILKPLDVGLDTTLV
LTTDRRTYHFRLRSSRTQLMPFVSFTYPEDAMAKWDAIKARETKVRQDNTIPHTGEYLGNLSFDYVVSGS
ARWKPVRVYNDGRKTIIEMPSKMQQSEAPALLVVHKDGSLFKDDETQMVNYRIQDARYIVDTIFDKAILV
SGVGSSQQKVTITRGN
 
Nucleotide Sequence: 891 bp     [Download]
>gi|182682734|ref|NC_010579.1|:3605-4495 Xylella fastidiosa M23 plasmid pXFAS01, complete sequence
ATGCAAAAGACTTTAATCTCCGCTCTGATTCTCGGCTTAGTGCCGATGGTGACATTCGCAGCTCCTGGCA
CCGACCCGTTGGCCGATCAGTATTTCTCGAAAAACGAGCCGAAGTTGACGACGCAGGAGAAGGCGGCTGT
CGCTATTGGCAAAAAGTGGCAGGAGAGTCAGGACCTCAAGCCGTTCCAAGGTTCTGACGGTTCGATCAAC
TGGCCGTACTTACCTGGCAAGCAATACCCGATCATGTGTGCAGTGCTGCAAGTCTGTGACATTGCTTTAC
AGCCAGGTGAGAATGTCAATGGCACGAACATTGGCGATCCTCGCTATCATGTTGAGCCAGCCGTCACAGG
TTCAGGTGCGTCGCAAATAATACATCTGATCTTGAAGCCTCTTGATGTGGGTCTTGATACGACGCTCGTG
CTCACCACGGATCGGCGCACGTATCACTTTCGCCTGCGTTCTAGTCGCACGCAGCTCATGCCGTTTGTAT
CGTTCACGTATCCCGAAGACGCGATGGCGAAATGGGATGCAATCAAAGCCCGCGAAACAAAGGTACGCCA
GGACAATACTATTCCGCATACCGGTGAGTACCTGGGGAACCTCAGCTTTGATTACGTAGTGAGCGGTTCG
GCTCGCTGGAAGCCGGTTCGGGTCTACAACGATGGCCGTAAAACCATCATCGAAATGCCTTCAAAAATGC
AACAAAGTGAAGCGCCAGCACTGCTTGTCGTCCATAAGGACGGAAGCCTGTTCAAAGATGATGAGACGCA
AATGGTGAACTATCGCATTCAAGACGCCCGCTACATCGTAGATACGATCTTTGACAAAGCGATCCTCGTA
TCCGGTGTTGGTTCGAGTCAACAGAAGGTAACGATCACGAGGGGGAACTAA
 Primer design