SecReT4
Protein ID: 182682739
T4SS name [ID]Trb [59]
Gene symbol-
Locus tagXfasM23_2231
StrainXylella fastidiosa M23
Repliconplasmid pXFAS01 [GenBank: NC_010579] [Browse all T4SS(s) in this replicon]
Location [Strand]4498..4974 [+]
Productconjugal transfer protein TrbH
Component typeTrbH
UniProt IDB2IAS5
KEGG IDxfn:XfasM23_2231
PDB IDNA
Domain hit(s) vs Pfam TrbH [PF07283], Evalue: 1.8e-45, Aligned region: 30..158
Protein Sequence: 158 a.a.     [Download]
>gi|182682739|ref|YP_001830937.1| conjugal transfer protein TrbH [Xylella fastidiosa M23]
MRKFMMSVVVLAALTSCATQNMHGNYAAVSIEANKTMADVTVAQLVALYPPAHTRLDLQQTITDPYGAAL
LSALRKKGYSVLEYNPQPQAVPAKSAATAALATANPTPGLPLSYVVDSPESMNLYRITVQIGVQSISRAF
VVATNGNLYPAGAWVRKE
 
Nucleotide Sequence: 477 bp     [Download]
>gi|182682734|ref|NC_010579.1|:4498-4974 Xylella fastidiosa M23 plasmid pXFAS01, complete sequence
ATGCGTAAGTTCATGATGAGTGTGGTCGTGCTTGCTGCTCTGACAAGCTGTGCAACACAAAACATGCATG
GTAATTATGCGGCGGTGTCCATTGAAGCCAATAAAACAATGGCCGATGTAACGGTAGCCCAGCTCGTGGC
ACTGTATCCGCCCGCACATACGCGCTTGGATCTTCAACAGACAATCACGGACCCCTACGGTGCAGCATTG
TTATCCGCGTTGCGAAAGAAAGGTTATTCCGTATTGGAGTACAACCCGCAGCCGCAGGCTGTGCCTGCTA
AATCTGCGGCGACCGCAGCGCTTGCCACAGCTAATCCAACACCAGGCTTACCCCTTAGTTACGTGGTCGA
TTCCCCTGAGTCAATGAATCTGTACCGCATCACGGTTCAGATTGGTGTGCAGTCGATCAGTAGAGCATTC
GTGGTTGCCACGAACGGCAATCTGTATCCGGCAGGTGCATGGGTTCGTAAGGAGTAA
 Primer design