SecReT4
Protein ID: 182682740
T4SS name [ID]Trb [59]
Gene symbol-
Locus tagXfasM23_2232
StrainXylella fastidiosa M23
Repliconplasmid pXFAS01 [GenBank: NC_010579] [Browse all T4SS(s) in this replicon]
Location [Strand]4980..6380 [+]
Productconjugal transfer protein TrbI
Component typeTrbI
UniProt IDB2IAS6
KEGG IDxfn:XfasM23_2232
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.5e-59, Aligned region: 271..457
Protein Sequence: 466 a.a.     [Download]
>gi|182682740|ref|YP_001830938.1| conjugal transfer protein TrbI [Xylella fastidiosa M23]
MVDNDQMSPDASPNSKPRSGVRRVNNLPLIIVIVVLCLFALLIAKVALKRMNNVAVAQSDTQKVSKKNID
TSTMANEVLSGHGPGIIPSAMPEVPSAVSATAGIPIAPVNNPDAPPMPPHQPDSLSAPVNPDEQQLRMAK
LQQFQEAIKAKSKITLPYDGSGSPSTSMTSRGASATATPQSREEMLAQIAKVRQQIDENAAGGDLTSSYQ
AQLARIRASLGNGDGGSESSPHLLQVSASSSNKDFSQFANNGQGDRWKLDQEIQAPRSSFEIRAGGVIPG
VMISGVNSDLPGQIMGQVAQDVYDTATGKYLLIPQGTRLVGMYNSNVAYGQGAILIAWQRLVFPDGKALD
ISAMPGADNAGYAGFRDHANHHYMRIFGSALLMSGVTAASSYATDRNRNNSGIYSQPTASSELSQALGQQ
LGNVTAQMISKNLNIAPTLQIRPGYRFNIIIVKDLNFTKPYKSFDY
 
Nucleotide Sequence: 1401 bp     [Download]
>gi|182682734|ref|NC_010579.1|:4980-6380 Xylella fastidiosa M23 plasmid pXFAS01, complete sequence
ATGGTTGATAACGATCAAATGTCACCGGACGCCTCGCCAAACTCCAAGCCGAGAAGCGGCGTTCGTCGGG
TCAATAACTTACCGCTCATCATCGTGATCGTTGTACTTTGCCTGTTTGCTTTATTGATTGCGAAGGTGGC
TCTCAAGCGTATGAATAATGTCGCAGTGGCCCAGTCGGATACACAAAAAGTGTCGAAGAAGAACATCGAT
ACAAGCACGATGGCGAATGAAGTGCTGAGCGGCCACGGTCCAGGCATTATTCCTTCGGCTATGCCAGAGG
TGCCATCGGCTGTCAGCGCGACGGCTGGTATTCCGATTGCGCCGGTCAACAATCCTGACGCACCACCGAT
GCCACCGCATCAGCCGGATAGCTTGTCGGCTCCTGTCAATCCTGATGAACAACAGCTTCGTATGGCGAAG
CTCCAGCAGTTTCAGGAAGCGATTAAGGCTAAATCCAAGATCACATTACCCTATGACGGTAGTGGTTCTC
CAAGCACGTCGATGACCTCACGAGGAGCTAGTGCAACGGCTACCCCACAATCACGCGAAGAAATGCTCGC
ACAGATTGCGAAGGTGCGACAGCAAATCGACGAGAACGCAGCAGGTGGCGATCTGACAAGTTCTTATCAA
GCACAGTTGGCAAGGATTCGTGCGAGCCTTGGAAATGGTGATGGCGGTTCAGAGAGCAGTCCGCACCTTT
TGCAGGTCTCTGCATCGTCCAGCAACAAGGATTTCTCACAGTTTGCCAACAATGGGCAAGGCGATCGCTG
GAAGCTAGATCAAGAGATACAAGCTCCGCGTTCTAGCTTTGAGATTCGTGCCGGTGGCGTTATTCCTGGT
GTAATGATTAGCGGCGTGAACTCTGATTTGCCTGGTCAAATCATGGGACAAGTGGCCCAGGACGTGTATG
ACACGGCAACGGGAAAATATTTACTGATCCCCCAGGGGACACGCTTAGTGGGCATGTACAACAGTAACGT
GGCGTATGGGCAAGGTGCGATCCTTATTGCATGGCAACGTCTGGTGTTTCCCGATGGCAAGGCACTGGAC
ATCAGTGCGATGCCTGGTGCGGATAATGCTGGTTACGCGGGTTTTCGCGATCACGCCAATCATCATTACA
TGCGCATCTTCGGGTCTGCACTGCTGATGTCAGGTGTGACGGCTGCGTCGTCGTATGCGACGGATCGAAA
CAGAAACAACAGTGGCATCTACAGCCAACCAACCGCCAGTAGTGAGTTGAGTCAGGCACTCGGCCAACAG
CTCGGCAACGTAACGGCGCAGATGATCTCGAAGAATCTGAACATTGCTCCGACTCTCCAAATTCGCCCTG
GCTATCGTTTCAACATCATCATTGTGAAGGACCTCAATTTCACAAAGCCGTACAAATCTTTTGATTACTG
A
 Primer design