SecReT4
Protein ID: 182682741
T4SS name [ID]Trb [59]
Gene symbol-
Locus tagXfasM23_2233
StrainXylella fastidiosa M23
Repliconplasmid pXFAS01 [GenBank: NC_010579] [Browse all T4SS(s) in this replicon]
Location [Strand]6399..7172 [+]
Productconjugal transfer protein TrbJ
Component typeTrbJ
UniProt IDB2IAS7
KEGG IDxfn:XfasM23_2233
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 4.3e-05, Aligned region: 31..214
Protein Sequence: 257 a.a.     [Download]
>gi|182682741|ref|YP_001830939.1| conjugal transfer protein TrbJ [Xylella fastidiosa M23]
MRMFLKNTFTIKNAGIAFVLLVGISQQTQAGMPVIDISNLEQNIVSAVQQVAAVEKQIQQYQTQLQQYQN
MLQNTAAPSAYIWDQASQVMNKLMVAQDTLSYYKKKAGSIDSYLSRYQDVNYYRTSPCFTAAGCSSSQLQ
ALQDAQANNSEALKHANDAVLKGIDQQQQTLISDAATLQKLQLQATTAQGQMQALQAANQLASAQTNQLL
QIRSMLAAQATAAATRASNDADKAALMEAADQRFRSGSYTKSPVKKW
 
Nucleotide Sequence: 774 bp     [Download]
>gi|182682734|ref|NC_010579.1|:6399-7172 Xylella fastidiosa M23 plasmid pXFAS01, complete sequence
ATGAGAATGTTCTTAAAAAATACTTTCACCATTAAAAATGCTGGCATAGCGTTTGTTCTGCTTGTTGGTA
TCTCGCAGCAAACACAAGCCGGTATGCCGGTGATCGACATAAGCAATCTGGAACAAAATATCGTCAGTGC
AGTGCAGCAGGTTGCGGCTGTCGAGAAGCAGATTCAGCAGTACCAGACGCAGTTACAACAGTATCAAAAC
ATGTTGCAAAACACGGCTGCACCGAGCGCTTACATTTGGGACCAGGCAAGTCAGGTGATGAACAAGCTTA
TGGTGGCGCAAGACACATTGAGCTACTACAAGAAGAAGGCTGGCAGCATCGATTCGTACCTGTCGCGCTA
TCAAGACGTTAACTATTACCGCACCTCGCCCTGCTTTACTGCTGCGGGTTGCTCGTCTTCGCAGTTGCAA
GCTCTGCAAGATGCGCAGGCAAACAATTCGGAAGCGCTGAAACATGCAAACGATGCAGTGCTTAAAGGTA
TCGATCAGCAACAACAGACACTCATTAGCGACGCTGCGACACTCCAAAAGCTGCAATTGCAGGCAACGAC
AGCACAGGGACAAATGCAGGCATTGCAGGCAGCAAACCAGCTTGCCAGTGCGCAAACCAACCAACTCTTA
CAGATTAGGAGCATGTTGGCTGCGCAGGCTACTGCGGCCGCGACTCGGGCGTCTAACGATGCAGATAAGG
CAGCGCTGATGGAAGCGGCTGATCAGAGGTTCCGCTCGGGAAGCTATACGAAAAGTCCGGTTAAGAAATG
GTAA
 Primer design