SecReT4
Protein ID: 182682743
T4SS name [ID]Trb [59]
Gene symbol-
Locus tagXfasM23_2235
StrainXylella fastidiosa M23
Repliconplasmid pXFAS01 [GenBank: NC_010579] [Browse all T4SS(s) in this replicon]
Location [Strand]7447..8817 [+]
ProductP-type conjugative transfer protein TrbL
Component typeTrbL
UniProt IDB2IAS9
KEGG IDxfn:XfasM23_2235
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 8.4e-31, Aligned region: 59..272
Protein Sequence: 456 a.a.     [Download]
>gi|182682743|ref|YP_001830941.1| P-type conjugative transfer protein TrbL [Xylella fastidiosa M23]
MPMLALALLLFAAQAQAQAPVDSVGLLDNILRRFQQVTNTWSGEIIRYASLLFWSLSLLSMTWTYGMMVL
RKADIQEFLAETIRFFAIMGFFWWLLINAPAMSTAIIDSLRQIAANATGLDNTLSPSGIVDIGFDITSKV
IDDSSITSPVNSAVGIIASTVILIVLALIAVNMLLLLVSGWLLSYGAVFLLGFGGGRWTSDIAISYYKTV
IGLGMQLFAMILIIGIGRSFIDQYYAAVMASTITIKALLVMLVASIVLLSLVNKIPPMFASIVGGGGATA
GIGNFGAGAAIAAAATGAAVAATAGSAIAAGVSSAGGGVSALKAAFQSAQQNMASGGGSGSGSGGNSAGV
SSGGSSSFMSAMGTTGRFAADMGTSLAKGVGQVVKDKAGSMIASAKERVADTTGGKVASAIRNNIGAMSG
QDDFKGDSLAGAAQRGSETAMHDEVAAFVNKGKQHE
 
Nucleotide Sequence: 1371 bp     [Download]
>gi|182682734|ref|NC_010579.1|:7447-8817 Xylella fastidiosa M23 plasmid pXFAS01, complete sequence
ATGCCAATGCTTGCATTGGCGTTATTGCTGTTTGCCGCACAAGCGCAAGCACAAGCACCTGTCGATAGCG
TCGGTTTGTTGGACAACATTCTCCGACGTTTCCAACAGGTCACTAATACTTGGTCTGGCGAGATAATTAG
ATACGCGAGCTTGCTCTTTTGGAGCTTATCACTGCTGAGTATGACCTGGACCTATGGGATGATGGTTTTA
CGTAAGGCTGACATTCAGGAGTTTCTTGCTGAGACGATCCGGTTCTTTGCGATAATGGGCTTCTTCTGGT
GGCTCCTGATCAACGCTCCAGCTATGTCGACAGCGATCATCGATTCGCTGCGGCAAATTGCAGCCAACGC
TACGGGATTAGATAACACGCTCTCGCCATCAGGAATTGTCGATATTGGCTTTGACATTACCTCAAAGGTT
ATTGACGATAGCTCCATCACGTCGCCTGTTAACTCTGCCGTTGGCATCATCGCTTCGACTGTGATTCTTA
TTGTGCTGGCTCTCATTGCCGTGAACATGCTACTGCTGCTTGTATCGGGATGGCTGCTGTCCTATGGAGC
GGTTTTCCTACTAGGATTCGGTGGTGGTCGGTGGACCTCAGATATTGCAATTAGCTACTACAAGACGGTA
ATCGGCCTTGGTATGCAGTTATTCGCAATGATCTTGATTATTGGCATTGGCAGGTCTTTCATCGACCAGT
ACTACGCGGCTGTCATGGCCAGTACGATCACAATAAAGGCTCTTTTGGTTATGCTAGTGGCGTCTATCGT
TTTGCTTTCGTTAGTCAACAAGATTCCTCCGATGTTTGCCAGCATCGTAGGCGGTGGTGGCGCTACGGCT
GGCATTGGCAACTTTGGCGCGGGTGCAGCCATTGCTGCGGCGGCTACAGGAGCTGCTGTAGCGGCGACGG
CCGGCTCTGCTATCGCCGCTGGTGTATCAAGCGCTGGGGGTGGTGTTTCGGCTCTCAAGGCAGCATTCCA
GTCTGCCCAGCAAAACATGGCGAGCGGTGGTGGTTCTGGATCAGGTTCAGGCGGAAATTCTGCTGGAGTA
TCCTCTGGCGGCAGTAGCAGCTTCATGTCGGCGATGGGTACAACTGGACGCTTTGCTGCTGACATGGGAA
CGAGTCTTGCCAAAGGTGTTGGCCAAGTTGTTAAAGACAAGGCTGGAAGCATGATCGCATCCGCTAAAGA
GCGGGTCGCAGACACGACCGGCGGCAAGGTTGCATCCGCAATTCGCAACAACATAGGTGCAATGTCTGGG
CAAGACGACTTCAAAGGTGACAGCCTAGCAGGTGCAGCTCAGAGAGGTTCTGAGACGGCCATGCATGATG
AGGTCGCTGCCTTTGTGAACAAAGGTAAGCAGCATGAGTAA
 Primer design