SecReT4
Protein ID: 182682744
T4SS name [ID]Trb [59]
Gene symbol-
Locus tagXfasM23_2236
StrainXylella fastidiosa M23
Repliconplasmid pXFAS01 [GenBank: NC_010579] [Browse all T4SS(s) in this replicon]
Location [Strand]8823..9422 [+]
Productconjugal transfer protein TrbN
Component typeTrbN
UniProt IDB2IAT0
KEGG IDxfn:XfasM23_2236
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 199 a.a.     [Download]
>gi|182682744|ref|YP_001830942.1| conjugal transfer protein TrbN [Xylella fastidiosa M23]
MPFLDLPPQIQERVVCSITAAVKYEVPANIVLAVAEQEGGKPGQWVRNTNGTHDVGPMQFNTAYLVELRQ
YGITPQDVARGGCYSYDLAAWRLRGHLRNDQGDIWTRAANYHSRTPQYNAVYRISLIKRAGKWENWLVAR
FPTFDTIQASKPVMAANTTPRVKVEMPRSSVVNTSMPVGHYNAAAADALEAVFGQKDLF
 
Nucleotide Sequence: 600 bp     [Download]
>gi|182682734|ref|NC_010579.1|:8823-9422 Xylella fastidiosa M23 plasmid pXFAS01, complete sequence
ATGCCCTTCCTTGATCTGCCACCGCAAATACAAGAGCGCGTTGTTTGCTCGATTACGGCTGCCGTCAAGT
ACGAAGTTCCAGCAAACATTGTATTGGCAGTAGCCGAACAAGAGGGCGGCAAGCCAGGCCAATGGGTCAG
GAACACAAATGGCACACATGATGTGGGACCAATGCAGTTCAATACGGCCTATTTGGTCGAGCTACGTCAA
TATGGGATCACGCCACAAGACGTAGCACGGGGTGGGTGCTATTCCTATGATCTGGCTGCGTGGCGTTTGC
GTGGTCACTTACGTAATGATCAAGGTGACATTTGGACGCGGGCTGCGAATTACCATTCGCGTACACCGCA
ATATAATGCTGTTTATCGCATCTCTCTCATTAAGCGTGCCGGTAAGTGGGAAAACTGGCTCGTCGCTCGC
TTTCCCACGTTTGACACCATACAAGCGAGTAAGCCGGTTATGGCAGCTAATACGACACCAAGGGTAAAGG
TTGAGATGCCAAGGTCTTCCGTCGTGAATACCTCAATGCCCGTTGGGCATTACAATGCAGCAGCAGCAGA
TGCTCTTGAGGCAGTATTTGGACAGAAAGATTTATTCTGA
 Primer design