SecReT4
Protein ID: 182682755
T4SS name [ID]Trb [59]
Gene symbol-
Locus tagXfasM23_2247
StrainXylella fastidiosa M23
Repliconplasmid pXFAS01 [GenBank: NC_010579] [Browse all T4SS(s) in this replicon]
Location [Strand]21449..21985 [-]
Productconjugal transfer peptidase TraF
Component typeTraF
UniProt IDB2IAU1
KEGG IDxfn:XfasM23_2247
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 6.4e-42, Aligned region: 32..177
Protein Sequence: 178 a.a.     [Download]
>gi|182682755|ref|YP_001830953.1| conjugal transfer peptidase TraF [Xylella fastidiosa M23]
MNRMINRAVAVLVVVGILGIAASGVMCLVGARVNTSKSIPIGLYWTSSAPVTKGKYVIFCPPQRTVFDNA
RKRGYIGPGFCPGGYGYMMKKILAAKGDTVSVTPQGVAVNGRLLPYSKPLLVDGVGRSMPRMSDERYTLG
ESELLLMTDRSSTSFDARYYGIISREQVKSVIRPVLTW
 
Nucleotide Sequence: 537 bp     [Download]
>gi|182682734|ref|NC_010579.1|:c21985-21449 Xylella fastidiosa M23 plasmid pXFAS01, complete sequence
ATGAACCGCATGATTAATCGTGCCGTCGCCGTATTGGTTGTGGTCGGCATTTTGGGGATTGCGGCCAGTG
GCGTTATGTGTTTGGTCGGCGCTCGTGTGAATACAAGCAAGAGTATTCCAATCGGACTGTACTGGACGAG
TAGTGCGCCCGTTACCAAGGGAAAATACGTCATTTTTTGCCCGCCGCAGCGGACAGTGTTCGATAACGCA
AGAAAGCGTGGCTATATCGGTCCAGGATTCTGTCCTGGTGGCTACGGTTACATGATGAAGAAAATTTTAG
CCGCTAAAGGCGACACGGTTTCTGTGACACCACAGGGAGTTGCTGTCAACGGAAGGTTGTTGCCATACAG
CAAACCATTACTGGTTGATGGTGTCGGTCGGTCTATGCCTCGTATGAGTGACGAGCGATACACGCTTGGC
GAATCCGAACTGTTGCTGATGACTGACAGAAGTTCAACGTCATTTGATGCTCGTTACTACGGAATCATCA
GCCGCGAACAAGTGAAGTCAGTGATCCGACCCGTTCTCACTTGGTAA
 Primer design