SecReT4
Protein ID: 182682756
T4SS name [ID]Trb [59]
Gene symbol-
Locus tagXfasM23_2248
StrainXylella fastidiosa M23
Repliconplasmid pXFAS01 [GenBank: NC_010579] [Browse all T4SS(s) in this replicon]
Location [Strand]21982..23916 [-]
Productconjugal transfer coupling protein TraG
Component typeTraG
UniProt IDB2IAU2
KEGG IDxfn:XfasM23_2248
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 3.1e-145, Aligned region: 119..417
T4SS-DNA_transf [PF02534], Evalue: 3.1e-145, Aligned region: 429..627
TraG-D_C [PF12696], Evalue: 7.2e-30, Aligned region: 452..576
TrwB_AAD_bind [PF10412], Evalue: 1.9e-22, Aligned region: 179..576
Protein Sequence: 644 a.a.     [Download]
>gi|182682756|ref|YP_001830954.1| conjugal transfer coupling protein TraG [Xylella fastidiosa M23]
MRKPNNAVGPQVRGGQRKKNKLVPALALTSMATGLQVATQYFAHTFNYQSTLGGNYNHIYAPWSILSWYA
KWGDQFHNYFFAAGNIGMMVTAGGLIGTALIKTFEINSVKANEYLHGSACWASKKDIEQSGLLGNDEGVY
VGAWEDKDGRLHYLRHNGPEHVLTYAPTRSGKGVGLVVPTLLSWPHSVVVTDLKGELWAMTAGWRQKHAK
NKVIRFEPATLNGSVCWNPLDEIRIGTEYEVGDVQNLATLIVDPNGKGLESHWQKTSQALLVGVILHVLY
KRKNEGFPATLSYVDHIMSDPNRNVAELWMEMTQYGHINGENHPAVGSAGRDMMDRPEEEAGSVLSTAKS
YIALYRDPVVARNVSKSDFCIKDLMNHDDPVSLYIVTQPNDKGRLRPLVRVMLNMIVRLLADKMKFERVP
TELSWWRQILTKLGFNQVADFHVRSKKSYKHRLLGMIDEFPSLGKLEIMQESLAFVAGYGIKFYLICQDL
NQLKSRETGYGPDETITSNCHVQNAYPPNRVETAEHLSKLTGQTTVLKEQITTSGKRATPILGQLSRTIQ
EVQRPLLTVDECLRMPGPKKDAEGQITEAGDMVVYVAGYPAIYGKQPLYFQDPIFIARAAVPEPKTSDTL
RLVHEPTLLDEIKI
 
Nucleotide Sequence: 1935 bp     [Download]
>gi|182682734|ref|NC_010579.1|:c23916-21982 Xylella fastidiosa M23 plasmid pXFAS01, complete sequence
ATGAGAAAGCCAAACAATGCTGTCGGTCCACAGGTTCGAGGGGGACAGCGCAAAAAGAACAAGCTGGTTC
CTGCACTTGCTCTTACTTCGATGGCGACTGGCTTGCAGGTCGCAACGCAATACTTCGCGCACACATTCAA
CTATCAATCAACACTTGGTGGGAATTACAACCACATATACGCCCCTTGGTCGATTCTTTCGTGGTATGCC
AAGTGGGGCGATCAGTTTCATAACTATTTTTTTGCCGCTGGCAACATTGGCATGATGGTTACTGCCGGTG
GTCTCATCGGTACAGCACTGATAAAAACGTTCGAAATCAACTCAGTCAAAGCCAACGAGTATCTTCATGG
ATCGGCCTGCTGGGCGAGTAAGAAGGACATCGAGCAGTCAGGTTTGCTCGGTAACGACGAAGGCGTATAC
GTAGGTGCCTGGGAGGACAAGGATGGAAGGCTTCATTATCTACGTCATAACGGTCCCGAGCATGTTCTGA
CCTACGCCCCCACTCGTTCTGGTAAAGGGGTCGGTCTCGTTGTCCCCACATTGCTGTCGTGGCCGCACAG
CGTCGTCGTTACTGACCTTAAGGGTGAGCTATGGGCGATGACTGCTGGCTGGCGTCAGAAGCACGCCAAG
AACAAGGTGATTCGCTTTGAACCAGCCACGCTTAACGGATCGGTGTGCTGGAATCCGCTCGATGAAATTC
GTATCGGGACGGAATACGAAGTTGGCGATGTGCAGAACCTCGCAACCCTCATCGTTGATCCGAATGGCAA
AGGTCTCGAATCGCACTGGCAGAAAACGTCACAAGCCCTACTTGTTGGCGTGATCTTGCACGTTCTTTAC
AAGAGGAAGAACGAAGGTTTTCCGGCGACGTTGTCATACGTGGATCACATCATGTCAGACCCTAACCGTA
ACGTGGCCGAGTTGTGGATGGAGATGACGCAGTACGGCCATATCAACGGTGAAAATCATCCGGCTGTCGG
TTCAGCGGGTCGAGACATGATGGACCGGCCCGAGGAAGAGGCTGGTTCTGTCTTGTCTACGGCGAAGTCC
TACATTGCTCTTTATCGTGATCCGGTCGTCGCGAGAAACGTCAGTAAGTCCGATTTTTGCATCAAAGACT
TGATGAACCACGATGATCCGGTCAGTTTGTATATCGTGACTCAGCCGAACGACAAGGGCCGATTGCGGCC
TCTAGTCCGTGTGATGCTGAATATGATCGTGCGGCTGCTTGCCGACAAAATGAAGTTCGAACGTGTACCC
ACAGAGCTGTCTTGGTGGCGTCAAATACTTACCAAACTTGGATTCAATCAAGTTGCTGATTTCCACGTGC
GTTCAAAGAAGTCATACAAGCATCGTCTGTTGGGAATGATTGATGAGTTTCCGAGTCTCGGTAAGCTCGA
AATCATGCAAGAGTCTCTTGCCTTCGTGGCAGGCTACGGCATTAAGTTCTATCTCATTTGTCAAGACTTG
AACCAACTTAAATCGCGTGAGACCGGCTACGGCCCCGACGAAACGATCACGTCGAACTGCCATGTACAGA
ATGCTTACCCACCTAATCGTGTTGAGACGGCTGAGCATCTTTCAAAACTTACAGGGCAAACCACTGTACT
CAAGGAACAGATCACGACGAGCGGCAAGCGGGCGACTCCAATTCTCGGACAGCTCTCCCGCACGATTCAG
GAGGTGCAGCGTCCCTTACTCACTGTAGACGAGTGCTTGCGTATGCCTGGGCCAAAGAAGGATGCCGAAG
GACAAATCACTGAGGCTGGGGACATGGTTGTATACGTTGCTGGTTATCCGGCTATTTACGGAAAGCAGCC
ACTCTACTTTCAAGATCCGATTTTCATCGCACGCGCAGCAGTGCCTGAGCCGAAGACCAGCGACACACTG
CGTCTTGTGCATGAGCCAACCCTGCTGGATGAGATCAAAATATGA
 Primer design