SecReT4
Protein ID: 182682773
T4SS name [ID]Trb [59]
Gene symbol-
Locus tagXfasM23_2265
StrainXylella fastidiosa M23
Repliconplasmid pXFAS01 [GenBank: NC_010579] [Browse all T4SS(s) in this replicon]
Location [Strand]36930..37892 [+]
Productconjugal transfer ATPase TrbB
Component typeTrbB
UniProt IDB2IAV9
KEGG IDxfn:XfasM23_2265
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 7.5e-82, Aligned region: 30..295
FtsK_SpoIIIE [PF01580], Evalue: 1.5e-06, Aligned region: 140..180
AAA_19 [PF13245], Evalue: 2.6e-06, Aligned region: 141..189
AAA_10 [PF12846], Evalue: 1.9e-05, Aligned region: 150..189
AAA_29 [PF13555], Evalue: 2.1e-05, Aligned region: 148..171
DEAD [PF00270], Evalue: 8.5e-05, Aligned region: 137..201
Protein Sequence: 320 a.a.     [Download]
>gi|182682773|ref|YP_001830971.1| conjugal transfer ATPase TrbB [Xylella fastidiosa M23]
MMQDEENHGSVSTRAIEKLRRDLGPVVMGALNDPETVEVLLNADGGIWQECLGKKMHQIGMMTPQRAEAV
VKTVAGYHGKTVTRLNPLIEGELPIDGSRFAGQLPPVVENPTFAIRKKAIAIFTLEQYVEAGIMTLEQAQ
VIRAAVKAHRNILVIGGTGSGKTTLINAIIYEMVQIDSSERICIIEDTGEIQCAALNKVQYHTTLEITMT
MLLKTILRMRPDRILVGEVRGPEALDLLDAWNTGHEGGAATLHANDEHSALTRLKSLISRNESAPDAIEP
LIGEAVHVIVHIARTDVGRRVQGIIEIQGYKNGCYITRNI
 
Nucleotide Sequence: 963 bp     [Download]
>gi|182682734|ref|NC_010579.1|:36930-37892 Xylella fastidiosa M23 plasmid pXFAS01, complete sequence
ATGATGCAGGACGAGGAAAATCACGGATCAGTCAGTACCCGTGCCATTGAAAAGCTGCGTCGCGATTTAG
GACCTGTCGTTATGGGTGCGCTTAACGATCCTGAGACAGTTGAGGTTCTACTGAACGCAGATGGCGGAAT
CTGGCAAGAATGCCTTGGGAAGAAGATGCATCAGATCGGTATGATGACGCCGCAACGAGCTGAAGCGGTT
GTTAAGACTGTTGCTGGCTATCACGGAAAAACGGTGACGCGCCTGAACCCGCTTATTGAAGGTGAATTGC
CTATTGATGGTTCGCGCTTCGCAGGACAGCTCCCCCCTGTGGTTGAAAATCCAACCTTCGCGATTCGTAA
AAAAGCAATCGCAATCTTTACCCTTGAACAATACGTTGAGGCCGGAATCATGACGCTCGAACAGGCTCAG
GTCATTCGGGCAGCAGTGAAGGCGCATCGAAACATTCTTGTGATTGGCGGCACTGGCTCTGGTAAGACAA
CGCTAATCAACGCAATCATCTACGAGATGGTGCAGATCGATTCATCAGAACGCATTTGTATCATTGAGGA
CACTGGTGAAATACAATGCGCCGCCTTGAATAAGGTCCAGTACCACACCACGCTGGAAATCACGATGACT
ATGCTGCTCAAGACGATCCTACGGATGCGTCCTGATCGTATTCTCGTTGGCGAAGTGCGTGGCCCCGAGG
CATTAGACCTTTTAGACGCATGGAATACAGGGCACGAAGGAGGTGCCGCCACATTGCACGCAAACGACGA
GCACTCTGCTCTTACCCGTTTGAAGTCACTCATTAGTCGTAATGAATCTGCTCCAGACGCTATCGAACCC
CTTATCGGCGAAGCAGTCCATGTGATTGTTCACATTGCCCGCACCGATGTTGGCCGCCGCGTACAAGGAA
TTATCGAGATTCAAGGATATAAAAATGGTTGCTATATCACACGAAATATCTGA
 Primer design