SecReT4
Protein ID: 182682774
T4SS name [ID]Trb [59]
Gene symbol-
Locus tagXfasM23_2266
StrainXylella fastidiosa M23
Repliconplasmid pXFAS01 [GenBank: NC_010579] [Browse all T4SS(s) in this replicon]
Location [Strand]37905..38297 [+]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDB2IAS0
KEGG IDxfn:XfasM23_2266
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.9e-16, Aligned region: 13..105
Protein Sequence: 130 a.a.     [Download]
>gi|182682774|ref|YP_001830972.1| conjugal transfer protein TrbC [Xylella fastidiosa M23]
MQFTKSCINVNYRVLLILCVALLLLIATHPAFASNTSGGGLPSDEWFTRIRASVTGPFAFTVAIIGIVGA
GAGLILGGDMNGFLRTLIFIVLVLSFLVAAQNSLSAITGQGAEITAFSHDLSNLLQARLA
 
Nucleotide Sequence: 393 bp     [Download]
>gi|182682734|ref|NC_010579.1|:37905-38297 Xylella fastidiosa M23 plasmid pXFAS01, complete sequence
ATGCAGTTCACCAAGTCTTGTATCAACGTTAATTATCGAGTGCTTCTTATCCTTTGCGTTGCGCTACTGC
TGTTGATTGCCACGCATCCGGCGTTCGCGTCAAACACGAGTGGCGGTGGTCTACCTTCAGATGAATGGTT
CACTAGAATTCGCGCGTCTGTGACAGGTCCGTTTGCATTTACCGTAGCGATTATTGGCATCGTTGGTGCT
GGTGCAGGGCTTATTCTTGGTGGTGACATGAACGGCTTCTTGCGCACGCTCATCTTCATCGTCCTGGTGT
TGTCCTTCTTGGTTGCCGCACAAAACAGCCTGAGTGCGATCACGGGGCAGGGTGCTGAAATTACGGCGTT
TTCGCATGATCTGAGCAATCTCTTACAAGCCAGGCTCGCGTAA
 Primer design