SecReT4
Protein ID: 182683131
T4SS name [ID]Tra_Tn [659]
Gene symbol-
Locus tagSPCG_0161
StrainStreptococcus pneumoniae CGSP14
Repliconchromosome [GenBank: NC_010582] [Browse all T4SS(s) in this replicon]
Location [Strand]160675..162060 [+]
Producthypothetical protein
Component typeOrf21_Tn
UniProt IDB2IQE9
KEGG IDspw:SPCG_0161, spw:SPCG_1321
PDB IDNA
Domain hit(s) vs Pfam FtsK_SpoIIIE [PF01580], Evalue: 1.5e-41, Aligned region: 187..365
AAA_10 [PF12846], Evalue: 4.4e-06, Aligned region: 222..259
DUF87 [PF01935], Evalue: 2.3e-05, Aligned region: 222..340
Protein Sequence: 461 a.a.     [Download]
>gi|182683131|ref|YP_001834878.1| hypothetical protein SPCG_0161 [Streptococcus pneumoniae CGSP14]
MKQRGKRIRPSGKDLVFHFTIASLLPVFLLVVGLFHVKTIQQINWQDFNLSQADKIDIPYLIISFSVAIL
ICLLVAFVFKRVRYDTVKQLYHRQKLAKMILENKWYESEQVKTEGFFKDSAGRTKEKITYFPKMYYRLKN
GLIQIRVEITLGKYQDQLLHLEKKLESGLYCELTDKELKDSYVEYTLLYDTIASRISIDEVEAKDGKLRL
MKNVWWEYDKLPHMLIAGGTGGGKTYFILTLIEALLHTDSKLYILDPKNADLADLGSVMANVYYRKEDLL
SCIETFYEEMMKRSEEMKQMKNYKTGKNYAYLGLPAHFLIFDEYVAFMEMLGTKENTAVMNKLKQIVMLG
RQAGFFLILACQRPDAKYLGDGIRDQFNFRVALGRMSEMGYGMMFGSDVQKDFFLKRIKGRGYVDVGTSV
ISEFYTPLVPKGYDFLEEIKKLSNSRQSTQATCEAEVAGVD
 
Nucleotide Sequence: 1386 bp     [Download]
>gi|182682970|ref|NC_010582.1|:160675-162060 Streptococcus pneumoniae CGSP14 chromosome, complete genome
ATGAAACAGCGTGGTAAAAGGATTCGCCCATCTGGTAAAGATTTAGTCTTTCATTTTACGATAGCGTCAC
TCCTGCCTGTTTTCCTGCTGGTTGTCGGACTGTTTCATGTGAAGACAATCCAGCAGATCAACTGGCAGGA
TTTTAACCTATCACAAGCAGATAAGATTGACATTCCCTATTTAATTATCAGTTTCAGTGTCGCAATTCTT
ATCTGCTTGCTGGTAGCGTTTGTATTCAAACGGGTTCGCTATGATACGGTTAAACAACTTTACCACCGTC
AAAAACTGGCAAAGATGATACTTGAAAACAAGTGGTATGAATCTGAACAGGTCAAAACAGAGGGTTTCTT
TAAAGATAGTGCTGGTCGTACAAAGGAAAAGATAACCTACTTCCCTAAAATGTATTATCGACTTAAAAAT
GGCTTGATACAGATACGGGTGGAAATCACGCTGGGAAAATATCAAGACCAACTCTTACACTTGGAAAAGA
AATTAGAGAGTGGCTTGTACTGTGAGCTGACGGATAAAGAGTTAAAGGATTCCTATGTGGAATATACTTT
GCTCTATGACACCATAGCCAGTCGTATTTCTATTGATGAAGTAGAAGCTAAAGATGGTAAACTTCGCTTA
ATGAAAAACGTATGGTGGGAATATGATAAGCTCCCTCATATGTTGATTGCTGGTGGTACAGGTGGCGGTA
AAACTTACTTTATACTGACACTGATTGAAGCCTTGCTTCATACAGATTCAAAACTGTATATTCTTGACCC
GAAAAATGCTGACCTTGCGGACTTAGGTTCTGTGATGGCAAATGTCTACTATAGAAAAGAAGACTTGCTT
TCTTGCATTGAAACATTCTATGAAGAAATGATGAAACGTAGTGAGGAAATGAAGCAGATGAAGAACTATA
AGACTGGCAAAAATTATGCTTACTTAGGTCTCCCGGCACACTTCTTAATCTTTGATGAATACGTCGCTTT
CATGGAAATGCTGGGAACAAAAGAAAACACCGCAGTTATGAATAAGCTGAAACAGATTGTCATGTTAGGT
CGTCAAGCTGGCTTCTTTCTAATACTGGCTTGTCAACGTCCAGACGCAAAATATTTAGGCGACGGAATCC
GTGATCAGTTTAATTTCAGAGTGGCTTTAGGTCGTATGTCTGAAATGGGCTATGGCATGATGTTTGGCAG
TGACGTACAAAAGGATTTCTTCTTAAAGCGAATCAAAGGTCGTGGCTATGTTGATGTAGGAACAAGTGTC
ATATCAGAGTTTTATACTCCCCTTGTACCAAAAGGATATGATTTCTTGGAGGAAATTAAAAAGTTATCCA
ACAGCAGACAGTCCACGCAGGCGACGTGCGAAGCGGAAGTCGCAGGTGTGGACTGA
 Primer design