SecReT4
Protein ID: 182683133
T4SS name [ID]Tra_Tn [659]
Gene symbol-
Locus tagSPCG_0163
StrainStreptococcus pneumoniae CGSP14
Repliconchromosome [GenBank: NC_010582] [Browse all T4SS(s) in this replicon]
Location [Strand]163486..163707 [+]
Producthypothetical protein
Component typeOrf19_Tn
UniProt IDB2IRY5
KEGG IDspw:SPCG_0163
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 73 a.a.     [Download]
>gi|182683133|ref|YP_001834880.1| hypothetical protein SPCG_0163 [Streptococcus pneumoniae CGSP14]
MNFGQNLYNWFLSNAQSLVLLAIVVIGLYLGFKHEFSKLIGFLIIAIIAVGLVFNAAGVKDILLELFNRI
IGA
 
Nucleotide Sequence: 222 bp     [Download]
>gi|182682970|ref|NC_010582.1|:163486-163707 Streptococcus pneumoniae CGSP14 chromosome, complete genome
ATGAATTTTGGACAAAACCTTTATAACTGGTTTCTATCAAACGCTCAATCACTGGTGCTTTTAGCAATCG
TTGTGATTGGCTTGTATCTTGGCTTCAAGCATGAGTTTAGCAAACTGATTGGCTTTTTAATTATTGCGAT
TATTGCGGTTGGCTTAGTCTTCAACGCTGCTGGAGTAAAAGACATTTTACTAGAGCTATTCAATCGCATT
ATTGGTGCTTAA
 Primer design