SecReT4
Protein ID: 182683135
T4SS name [ID]Tra_Tn [659]
Gene symbol-
Locus tagSPCG_0165
StrainStreptococcus pneumoniae CGSP14
Repliconchromosome [GenBank: NC_010582] [Browse all T4SS(s) in this replicon]
Location [Strand]164296..164802 [+]
Producthypothetical protein
Component typeOrf17_Tn
UniProt IDB2IRY7
KEGG IDspw:SPCG_0165
PDB IDNA
Domain hit(s) vs Pfam TcpE [PF12648], Evalue: 2.6e-34, Aligned region: 44..145
Protein Sequence: 168 a.a.     [Download]
>gi|182683135|ref|YP_001834882.1| hypothetical protein SPCG_0165 [Streptococcus pneumoniae CGSP14]
MGFLKSSIKSVGTLLLADFLFYGVAQSATPIFYERIDYMKKIRSYTSIWSVEKVLYSINDFRLPFPITFT
QMTWFVVSLFAVMILGNLPPLSMIEGAFLKYFGIPVAFTWFMSTKTFDGKKPYGFLKSVIAYALRPKLTY
AGKKVTLGRNQPQEAITAVRSEFYGISN
 
Nucleotide Sequence: 507 bp     [Download]
>gi|182682970|ref|NC_010582.1|:164296-164802 Streptococcus pneumoniae CGSP14 chromosome, complete genome
ATGGGATTTTTGAAATCGTCTATTAAATCTGTCGGTACATTACTACTGGCAGATTTTCTATTTTACGGGG
TGGCTCAATCAGCTACCCCTATTTTTTATGAAAGGATTGATTACATGAAGAAAATACGAAGCTATACCAG
TATCTGGTCTGTGGAAAAGGTACTGTATTCTATCAATGATTTTAGACTTCCGTTTCCCATAACCTTTACG
CAAATGACATGGTTTGTCGTGTCACTCTTTGCAGTGATGATACTTGGCAACTTGCCCCCTCTTTCCATGA
TAGAGGGAGCATTTCTCAAATACTTTGGGATTCCTGTGGCTTTCACATGGTTTATGTCTACAAAAACTTT
TGATGGTAAAAAGCCTTATGGATTTTTGAAGTCTGTCATTGCTTATGCACTGCGACCAAAGCTGACCTAT
GCAGGAAAAAAAGTAACGCTTGGCAGAAACCAGCCACAAGAAGCCATTACAGCAGTTAGGAGTGAATTTT
ATGGCATATCCAATTAA
 Primer design