SecReT4
Protein ID: 182683136
T4SS name [ID]Tra_Tn [659]
Gene symbol-
Locus tagSPCG_0166
StrainStreptococcus pneumoniae CGSP14
Repliconchromosome [GenBank: NC_010582] [Browse all T4SS(s) in this replicon]
Location [Strand]164735..167233 [+]
Producthypothetical protein
Component typeOrf16_Tn
UniProt IDB2IRY8
KEGG IDspw:SPCG_0166
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1.4e-33, Aligned region: 485..780
Protein Sequence: 832 a.a.     [Download]
>gi|182683136|ref|YP_001834883.1| hypothetical protein SPCG_0166 [Streptococcus pneumoniae CGSP14]
MAETSHKKPLQQLGVNFMAYPIKYIENNLVWNKDGECYAYYELVPYNYSFLSPEQKIQVHDSFRQLIAQN
RDGKIHALQISTESSIRSAQERSKNEVTGKLKAVAYDKIDQQTDALISMIGENQVNYRFFIGFKLLLNDQ
EFSMKSLTVEAKNALSDFVYDVNHKLMGDFVSMSNDEILRFQKMEKLLENKISRRFKIRRLDKDDFGYLI
EHLYGQTGTAYEEYEYHLSKKKLDNETLIKYYDLIKPTRCLVEEKQRYLKIQQEDETVYVAYFTINSIVG
ELDFPSSEIFYYQQQQFTFPIDTSMNVEIVANRKALSTVRNKKKELKDLDNHAWQSDNETSSNVAEALES
VNELETNLDQSKESMYKLSYVVRVSANDLDELKRRCNEVKDFYDDLSVKLVRPFGDMLGLHEEFLPASKR
YMNDYIQYVTSDFLAGLGFGATQMLGENEGIYVGYSLDTGRNVYLKPALASQGVKGSVTNALASAFVGSL
GGGKSFANNLIVYYAVLYGAQAVIVDPKAERGRWKETLPEISHEINIVTLTSDEKNKGLLDPYVIMKNPK
DSESLAIDILTFLTGISSRDGERFPILRKAIRAVTNSEVRGLMKVIEELRVENTPLSTSIADHIESFTDY
DFAHLLFSNGYVEQSISLEKQLNIIQVADLVLPDKETSFEEYTTMELLSVAMLIVISTFALDFIHTDRSI
FKIVDLDEAWSFLQVAQGKTLSMKLVRAGRAMNAGVYFVTQNTDDLLDEKLKNNLGLKFAFRSTDLNEIK
KTLAFFGVDPEDENNQKRLRDLENGQCLISDLYGRVGVIQFHPVFEELLHAFDTRPPVRKEV
 
Nucleotide Sequence: 2499 bp     [Download]
>gi|182682970|ref|NC_010582.1|:164735-167233 Streptococcus pneumoniae CGSP14 chromosome, complete genome
TTGGCAGAAACCAGCCACAAGAAGCCATTACAGCAGTTAGGAGTGAATTTTATGGCATATCCAATTAAAT
ACATTGAAAACAATCTCGTCTGGAATAAAGACGGGGAATGTTATGCTTACTATGAGCTTGTTCCTTACAA
TTACTCATTTCTAAGTCCAGAACAGAAAATACAAGTGCATGATTCTTTCAGACAGCTTATCGCACAAAAT
CGTGATGGCAAAATTCATGCTTTACAAATCAGTACAGAATCCAGCATACGTTCTGCACAAGAGCGTTCCA
AAAATGAAGTCACTGGCAAGCTCAAAGCGGTTGCCTATGACAAAATCGACCAACAGACAGACGCTTTAAT
ATCCATGATTGGCGAAAATCAAGTGAACTACCGTTTCTTTATCGGCTTTAAGTTGCTTCTCAACGATCAG
GAGTTTTCTATGAAAAGTCTTACCGTTGAAGCAAAAAATGCTTTGTCTGATTTTGTCTATGATGTGAACC
ATAAGCTGATGGGCGATTTTGTTAGTATGAGTAATGATGAAATCCTGCGTTTTCAGAAGATGGAAAAGCT
CTTAGAAAATAAAATCTCTCGTCGTTTCAAAATCCGCAGGTTAGATAAGGACGACTTCGGCTATCTGATT
GAACACCTTTACGGACAGACAGGCACTGCCTATGAAGAGTATGAGTACCATCTATCAAAGAAAAAGCTGG
ATAATGAAACGCTGATTAAATACTATGACTTGATTAAGCCTACTCGCTGTTTGGTGGAAGAAAAACAGCG
ATATTTGAAAATCCAGCAGGAAGATGAAACCGTCTATGTAGCTTACTTTACCATTAACAGCATTGTCGGA
GAACTGGACTTCCCGTCCTCTGAAATCTTCTACTACCAGCAACAGCAATTTACATTCCCGATTGATACGT
CAATGAATGTGGAAATTGTAGCGAATCGTAAAGCCCTATCTACTGTCCGCAATAAAAAGAAAGAACTGAA
AGACTTGGATAACCACGCTTGGCAAAGTGATAATGAAACCAGCTCCAATGTGGCGGAAGCTCTGGAAAGT
GTGAATGAGCTGGAAACCAATTTAGACCAAAGCAAGGAATCTATGTACAAGCTGTCTTATGTGGTAAGGG
TATCAGCAAATGATCTTGACGAACTCAAACGTCGTTGTAATGAAGTGAAAGATTTTTATGACGATTTAAG
CGTAAAACTGGTACGACCATTTGGGGATATGCTCGGCTTACATGAAGAATTTTTACCTGCCAGCAAGCGT
TATATGAATGATTATATTCAATACGTGACCTCTGATTTCCTCGCTGGTTTAGGTTTTGGTGCTACTCAAA
TGCTGGGGGAAAATGAGGGGATTTATGTTGGCTACAGCTTAGATACTGGACGCAATGTCTATCTGAAACC
TGCTCTTGCCAGTCAAGGGGTTAAGGGTTCAGTAACCAATGCGTTAGCGTCGGCTTTTGTTGGTTCGCTG
GGTGGTGGTAAATCCTTTGCGAATAACCTTATCGTCTATTATGCGGTGCTTTATGGGGCACAAGCAGTGA
TTGTAGACCCAAAAGCAGAACGTGGCAGATGGAAAGAAACCTTGCCAGAGATTTCCCATGAAATCAATAT
CGTCACTCTGACTTCTGATGAGAAAAACAAAGGCTTACTTGACCCTTATGTGATTATGAAAAATCCCAAA
GATTCTGAATCACTGGCTATTGATATTCTGACATTCCTTACGGGGATTTCCTCTCGTGATGGGGAACGCT
TCCCAATCCTTAGAAAAGCCATTCGTGCAGTAACCAATAGTGAAGTACGAGGGTTGATGAAAGTGATTGA
GGAATTACGGGTTGAGAATACGCCACTAAGTACCAGTATAGCCGACCATATCGAAAGTTTTACAGACTAT
GACTTTGCACATTTATTATTCAGTAATGGTTATGTGGAGCAGTCTATCAGCTTAGAAAAACAACTGAACA
TTATACAGGTTGCGGACTTGGTACTTCCCGACAAGGAAACTTCCTTTGAGGAATATACCACTATGGAGCT
TTTATCCGTTGCTATGCTGATTGTCATTAGTACCTTTGCTTTAGACTTTATCCATACAGACCGAAGCATT
TTCAAGATTGTAGATTTAGACGAAGCATGGAGCTTTTTACAGGTAGCACAAGGAAAAACACTATCTATGA
AGCTGGTTCGGGCTGGTCGTGCTATGAACGCTGGGGTATATTTCGTGACCCAAAATACAGACGACCTCTT
AGATGAAAAACTGAAAAATAACCTCGGCTTAAAATTTGCATTTCGTTCCACTGACCTTAACGAGATTAAA
AAGACCTTAGCCTTTTTTGGTGTAGACCCAGAGGACGAAAACAATCAGAAGCGATTGCGTGATTTGGAAA
ACGGGCAATGCCTTATCAGTGATTTATATGGTCGTGTCGGTGTGATACAGTTCCACCCTGTATTTGAAGA
ACTGCTCCATGCCTTTGATACCAGACCACCTGTGCGAAAAGAGGTGTAA
 Primer design