SecReT4
Protein ID: 182683138
T4SS name [ID]Tra_Tn [659]
Gene symbol-
Locus tagSPCG_0168
StrainStreptococcus pneumoniae CGSP14
Repliconchromosome [GenBank: NC_010582] [Browse all T4SS(s) in this replicon]
Location [Strand]169410..170411 [+]
Producthypothetical protein
Component typeOrf14_Tn
UniProt IDB2IRZ0
KEGG IDspw:SPCG_0168
PDB IDNA
Domain hit(s) vs Pfam Lysozyme_like [PF13702], Evalue: 8.1e-61, Aligned region: 46..202
NLPC_P60 [PF00877], Evalue: 1.2e-31, Aligned region: 224..329
Protein Sequence: 333 a.a.     [Download]
>gi|182683138|ref|YP_001834885.1| hypothetical protein SPCG_0168 [Streptococcus pneumoniae CGSP14]
MKLKTLVIGGSGLFLMVFSLLLFVAILFSDEQDSGISNIHYGGVNVSAEVLAHKPMVEKYAKEYGVEEYV
NILLAIIQVESGGTAEDVMQSSESLGLPPNSLSTEESIKQGVKYFSELLASSERLSVDLESVIQSYNYGG
GFLGYVANRGNKYTFELAQSFSKEYSGGEKVSYPNPIAIPINGGWRYNYGNMFYVQLVTQYLVTTEFDDD
TVQAIMDEALKYEGWRYVYGGASPTTSFDCSGLTQWTYGKAGINLPRTAQQQYDVTQHIPLSEAQAGDLV
FFHSTYNAGSYITHVGIYLGNNRMFHAGDPIGYADLTSPYWQQHLVGAGRIKQ
 
Nucleotide Sequence: 1002 bp     [Download]
>gi|182682970|ref|NC_010582.1|:169410-170411 Streptococcus pneumoniae CGSP14 chromosome, complete genome
ATGAAGTTGAAAACTTTAGTGATTGGTGGTTCTGGATTATTCTTGATGGTCTTCTCACTGCTTCTGTTTG
TTGCCATTTTATTTTCAGATGAACAGGACAGCGGAATTTCCAATATTCATTATGGAGGTGTGAATGTTTC
CGCAGAAGTGCTGGCTCATAAGCCTATGGTAGAAAAATATGCCAAAGAATATGGCGTTGAAGAATATGTC
AACATACTTCTTGCGATTATACAGGTGGAATCGGGCGGTACTGCGGAAGATGTTATGCAGTCCTCGGAAT
CCCTCGGTCTTCCACCTAATTCATTGAGTACAGAAGAATCCATTAAGCAAGGTGTGAAGTATTTCAGTGA
ATTATTAGCCAGTAGCGAAAGGCTCAGTGTAGATTTAGAATCGGTTATCCAGTCCTACAATTATGGTGGT
GGTTTCTTAGGGTATGTGGCTAATCGTGGAAATAAATATACCTTTGAACTGGCTCAAAGTTTCTCAAAAG
AGTATTCAGGTGGCGAAAAAGTGTCTTACCCCAATCCCATAGCCATACCTATCAATGGGGGCTGGCGATA
CAACTATGGCAATATGTTTTATGTGCAACTGGTAACGCAGTATCTTGTCACAACAGAGTTTGATGATGAT
ACGGTACAAGCCATCATGGACGAAGCACTGAAATATGAGGGCTGGCGATACGTTTACGGTGGAGCTTCCC
CGACTACTTCTTTTGATTGTAGCGGACTGACACAATGGACGTATGGAAAAGCTGGAATTAACTTACCACG
AACCGCACAACAGCAATATGATGTGACCCAGCATATCCCACTATCGGAAGCACAAGCTGGCGATTTGGTT
TTCTTTCATTCTACCTATAACGCTGGCTCTTATATTACTCATGTTGGGATATACCTTGGCAATAACCGTA
TGTTTCATGCAGGCGACCCAATCGGTTATGCCGACTTAACAAGCCCCTACTGGCAACAGCATTTAGTGGG
AGCAGGACGAATCAAACAATGA
 Primer design