SecReT4
Protein ID: 182683139
T4SS name [ID]Tra_Tn [659]
Gene symbol-
Locus tagSPCG_0169
StrainStreptococcus pneumoniae CGSP14
Repliconchromosome [GenBank: NC_010582] [Browse all T4SS(s) in this replicon]
Location [Strand]170408..171343 [+]
Producthypothetical protein
Component typeOrf13_Tn
UniProt IDB2IRZ1
KEGG IDspw:SPCG_0169
PDB IDNA
Domain hit(s) vs Pfam TpcC [PF12642], Evalue: 1e-62, Aligned region: 84..310
Protein Sequence: 311 a.a.     [Download]
>gi|182683139|ref|YP_001834886.1| hypothetical protein SPCG_0169 [Streptococcus pneumoniae CGSP14]
MRKEDLMMKFRKNQNKEKQIPKEKKPRVYYKVNPHKKVVIALWVLLGLSFSFAIFKHFTAIDTHTIHETT
IIEKEYVDTHHVENFVENFAKVYYSWEQSDKSIDNRMESLKGYLTDELQALNVDTVRKDIPVSSSVRGFQ
IWTVEPTGDNEFNVTYSVDQLITEGENTKTVHSAYIVSVYVDGSGNMVLVKNPTITNIPKKSSYKPKAIE
SEGTVDSITTNEINEFLTTFFKLYPTATASELSYYVNDGILKPIGKEYIFQELVNPIHNRKDNQVTVSLT
VEYIDQQTKATQVSQFDLVLEKNGSNWKIIE
 
Nucleotide Sequence: 936 bp     [Download]
>gi|182682970|ref|NC_010582.1|:170408-171343 Streptococcus pneumoniae CGSP14 chromosome, complete genome
ATGAGAAAGGAAGATTTAATGATGAAATTTAGAAAAAATCAGAATAAAGAAAAACAGATACCAAAGGAAA
AGAAACCTCGTGTCTACTATAAGGTCAATCCTCATAAAAAGGTTGTGATTGCCTTGTGGGTACTTTTAGG
GCTTAGTTTCAGCTTTGCGATATTCAAGCACTTTACAGCTATAGATACTCATACTATTCACGAAACAACT
ATCATAGAAAAGGAATACGTTGATACTCATCATGTAGAAAATTTTGTAGAGAACTTTGCGAAAGTCTACT
ATTCATGGGAGCAATCCGATAAGTCCATTGATAATCGAATGGAAAGTCTAAAAGGCTATCTGACAGATGA
ACTTCAAGCTCTCAATGTTGATACAGTACGCAAAGATATTCCTGTATCGTCTTCTGTAAGAGGATTTCAG
ATATGGACGGTAGAGCCAACTGGCGACAATGAGTTTAATGTAACCTACAGTGTAGACCAGCTCATTACAG
AGGGAGAAAATACAAAGACCGTCCACTCTGCTTATATAGTGAGTGTCTATGTAGATGGTTCTGGAAATAT
GGTACTGGTTAAGAATCCGACCATTACCAACATACCTAAGAAATCAAGTTATAAACCAAAAGCCATTGAA
AGTGAGGGGACGGTTGATTCCATTACAACCAATGAAATCAATGAGTTTTTAACGACGTTCTTCAAGCTCT
ATCCTACAGCGACAGCCAGTGAACTTTCCTACTATGTGAATGACGGGATATTAAAACCAATCGGAAAAGA
GTACATCTTTCAAGAACTGGTAAATCCTATTCACAATCGTAAGGATAATCAAGTCACGGTATCGCTGACA
GTGGAGTATATCGACCAGCAGACCAAAGCAACGCAGGTATCTCAATTTGATTTGGTACTTGAAAAGAACG
GGAGTAATTGGAAGATTATAGAATAA
 Primer design