SecReT4
Protein ID: 184160044
T4SS name [ID]Tra_F [523]
Gene symbol-
Locus tagACICU_p0058
StrainAcinetobacter baumannii ACICU
Repliconplasmid pACICU2 [GenBank: NC_010606] [Browse all T4SS(s) in this replicon]
Location [Strand]26558..28717 [+]
ProductType IV secretory pathway, VirD4 component
Component typeTraD_F
UniProt IDB2I3X2
KEGG IDabc:ACICU_p0058
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 1.8e-126, Aligned region: 170..550
TraG-D_C [PF12696], Evalue: 2.7e-27, Aligned region: 412..532
T4SS-DNA_transf [PF02534], Evalue: 2.8e-25, Aligned region: 298..534
AAA_10 [PF12846], Evalue: 6.6e-11, Aligned region: 185..490
Protein Sequence: 719 a.a.     [Download]
>gi|184160044|ref|YP_001840912.1| Type IV secretory pathway, VirD4 component [Acinetobacter baumannii ACICU]
MKAKNNSKAIEFTRGSEIWIHQFRMFISSMMNVIVFGLMITIGIVCAFLYIKLKDVHFLALSVQYDIWLK
SVFNNPDARVALKLNGVVRDYTLDQAQHIINPYFNQLKFYVFRAFILGILLSSFLVGGLIYYWFTYGKEV
MSDEQIRGSELVSNDALIYKIQSTKGFSPYKISNIPMVKNTEGTNVGIFGAPGSGKSQIFRDHLSQVRNN
KRKAIVYDPSGEFTSEFYRPGIDIILNPFDERMPYWSPFFEIRHDEHFDSIANAFVPVEGKDPYFGEAGR
TVLAEVMRELHANGIHSNKTLHDTIAHFTIEEISSVLEGTAASKHVDKKAEKTALAVLTTVQNKLRAFRY
LPDSGTQFSIRDWVSRPEEDSWIFLSLREEQKTTIEPLITLWFSIFIKAVMNLEPIHRELLWMYCDEFPT
LPKMDDLPLSLTNTRKFGLCHFLGLQDIPQLEEKYGEKIARSIISALQTKVFYRVNENETAKRMSEILGQ
MEVAEKNMSRSMGVNDSRDGDSFITQRRERFIVLPSEIMKLPDLTGYLRVPGDYPVTKITQKYHPHLKNV
PAFIERENMGFISAFAVAEALESQSNSDGKEPLVEQQNEEGNFFGNSTVPLVGNSSFFGKSNTTSENIYE
NSPLDLFHSQTEDSDLSLNEKNGIQPDEIIPDEDEKPKVVNNDRLHTFASYLAATDESSVQKNNDVTPDT
NSSNDSNESSFKDLFNNND
 
Nucleotide Sequence: 2160 bp     [Download]
>gi|184160017|ref|NC_010606.1|:26558-28717 Acinetobacter baumannii ACICU plasmid pACICU2, complete sequence
ATGAAAGCAAAGAATAACTCAAAAGCAATCGAATTTACGAGAGGTTCTGAAATATGGATTCATCAATTTC
GAATGTTTATTTCAAGCATGATGAATGTCATAGTTTTTGGCCTGATGATTACGATTGGCATTGTATGTGC
ATTTCTATACATTAAATTAAAGGATGTTCATTTTCTTGCTTTAAGTGTGCAATACGATATTTGGTTAAAG
TCAGTATTTAATAATCCAGATGCGAGAGTAGCACTGAAGCTAAATGGTGTTGTACGTGATTACACTCTTG
ATCAAGCTCAGCACATTATTAATCCCTATTTTAACCAATTAAAGTTTTATGTTTTTCGAGCATTTATTTT
AGGTATTCTTTTAAGCTCATTTCTAGTCGGTGGTCTTATTTATTACTGGTTTACTTATGGTAAGGAAGTA
ATGTCTGATGAACAAATTCGTGGTTCAGAACTAGTTTCTAATGACGCATTAATTTATAAAATCCAAAGTA
CGAAAGGATTCAGTCCATATAAAATTTCTAACATACCTATGGTAAAAAATACAGAAGGTACGAATGTTGG
TATTTTTGGTGCTCCTGGTTCTGGTAAGTCTCAAATTTTTAGAGATCATTTATCTCAGGTTAGAAACAAT
AAAAGAAAAGCTATCGTTTATGATCCTTCAGGAGAATTCACTTCAGAATTTTATCGACCAGGTATAGATA
TTATTCTAAATCCATTTGATGAACGTATGCCGTATTGGTCACCATTTTTTGAAATTCGTCATGATGAGCA
TTTCGATAGTATTGCTAATGCTTTTGTTCCAGTTGAGGGTAAAGATCCTTATTTTGGCGAAGCTGGTAGA
ACAGTATTAGCTGAAGTCATGCGTGAATTACATGCTAATGGTATACACTCAAATAAGACTCTCCATGACA
CGATTGCACATTTTACTATTGAAGAAATATCGTCTGTGCTTGAGGGAACGGCTGCTTCAAAGCATGTTGA
TAAAAAAGCTGAAAAGACGGCACTGGCTGTTCTTACAACAGTACAAAATAAATTAAGAGCATTTCGCTAT
TTACCAGATTCCGGTACACAGTTTTCTATACGTGATTGGGTAAGTCGGCCTGAAGAAGACTCATGGATTT
TCCTTTCGCTTAGAGAAGAACAGAAAACTACTATTGAACCACTTATTACGTTGTGGTTTTCAATATTCAT
TAAAGCCGTAATGAACTTAGAACCAATACATCGTGAACTATTATGGATGTATTGTGATGAGTTCCCAACT
CTACCAAAAATGGATGATTTACCTTTATCTCTTACAAATACTCGTAAATTCGGTTTATGTCATTTTTTAG
GACTACAAGATATTCCTCAACTTGAAGAAAAGTACGGAGAAAAAATTGCTCGTTCAATAATTTCAGCTTT
ACAAACGAAAGTGTTCTATCGAGTTAATGAAAATGAAACTGCGAAAAGAATGTCTGAAATTCTTGGACAG
ATGGAAGTTGCTGAAAAAAATATGTCTAGAAGTATGGGGGTTAATGATTCAAGAGACGGTGATAGTTTTA
TTACTCAAAGGAGAGAACGCTTTATTGTTTTACCATCTGAAATTATGAAGTTGCCAGATCTAACAGGATA
CTTAAGAGTTCCTGGTGATTATCCAGTTACGAAGATTACTCAGAAATATCATCCTCACTTAAAAAATGTT
CCAGCATTTATAGAACGAGAAAATATGGGTTTCATTTCTGCGTTTGCGGTTGCTGAAGCTTTAGAATCCC
AATCGAATTCTGATGGAAAAGAGCCATTAGTAGAACAACAAAATGAAGAAGGCAATTTCTTTGGGAATTC
TACTGTGCCACTTGTTGGAAATAGTAGTTTCTTTGGGAAATCTAATACAACCTCTGAAAATATTTATGAA
AATTCACCTTTAGATTTATTTCATTCTCAAACAGAAGATAGTGATTTATCACTTAATGAAAAAAACGGTA
TTCAACCAGACGAAATAATCCCGGACGAAGATGAAAAGCCTAAAGTTGTTAATAATGACAGACTACATAC
TTTTGCCAGCTATCTTGCCGCAACCGATGAATCAAGTGTTCAGAAAAATAATGACGTTACTCCTGACACT
AATTCAAGTAATGATTCTAATGAATCTAGTTTTAAAGACTTGTTCAATAACAATGATTAG
 Primer design