SecReT4
Protein ID: 184160045
T4SS name [ID]Tra_F [523]
Gene symbol-
Locus tagACICU_p0059
StrainAcinetobacter baumannii ACICU
Repliconplasmid pACICU2 [GenBank: NC_010606] [Browse all T4SS(s) in this replicon]
Location [Strand]28729..30879 [+]
ProductTrwC protein
Component typeTraI_F
UniProt IDB2I3X3
KEGG IDabc:ACICU_p0059
PDB IDNA
Domain hit(s) vs Pfam TrwC [PF08751], Evalue: 1.6e-84, Aligned region: 9..295
AAA_30 [PF13604], Evalue: 3e-42, Aligned region: 548..714
PIF1 [PF05970], Evalue: 5.7e-10, Aligned region: 556..664
Protein Sequence: 716 a.a.     [Download]
>gi|184160045|ref|YP_001840913.1| TrwC protein [Acinetobacter baumannii ACICU]
MLSVNNVVESGKALSYYQLDNYYTNEQQSLDQTEWYGRGAQVLGINGEQIEANIFKDLLEGRVEDQQLGR
VRKDENGQSYIDHRAGIDLTFSAPKSVSIMAEVFENQDVLQAHLDAVKDTISAIEDHYTQTRISVDGTIQ
KSESDNLVVALFNHNTSRALDPQTHTHAVVMNMTLNDKDSWTALSNEVIYDNQATIGSIYNSNLAQNLRA
IGLDVEVKDNQGNFEIAGFTPEMIQEFSQRRTQIIESLKSRGIDIEDAPASLREQAALKTRERKQAFNEA
ELRQVWKERASELGITQSFVDKLEDKIKTNQMNADPQPSEKTKKTYGKPDPQKMIRIYHLKGKRKFLAIN
LITLIKKHQINELTTLKRKIRAIAPLSGKSQKEPETQNMGQEAHIQDEGRLGKKQTEPKASNNSKDQTVP
RERPYQRKNRESQQVLISQKTKEAVYYAIGHHTEREMMIPETKILNTAMKFDIQEVTHEQVRAELNRLEK
EKIIVRVDGKLTTQRLAHSEVWSLQHIQNEQKSVSPIVDESQVKTRLDQEEQLRGRKFTPGQRASLETIF
SSESRYIGVDGLAGTGKTTMLHTLNKVASENGFIVKGMAATGVAAKNLELETGIPSKTMAMFQIKENELQ
KEIEKNGGVNRKNEIWIVDESSFVSQTNFKDILTLAKQANSRVVFLGDKLQLQSISAGKPFELVQNRGVL
KTSQMHDIIRQKKPGT
 
Nucleotide Sequence: 2151 bp     [Download]
>gi|184160017|ref|NC_010606.1|:28729-30879 Acinetobacter baumannii ACICU plasmid pACICU2, complete sequence
ATGCTAAGTGTTAACAATGTAGTTGAATCAGGAAAGGCTTTGTCTTACTACCAATTAGATAATTATTATA
CTAATGAGCAACAATCATTGGATCAAACTGAATGGTATGGTCGTGGTGCTCAAGTATTAGGTATTAATGG
TGAACAAATTGAGGCAAATATTTTTAAAGACTTGCTAGAAGGTAGAGTAGAAGATCAACAGTTGGGGCGA
GTTAGGAAAGATGAAAATGGTCAAAGTTATATTGATCATAGAGCTGGTATAGATTTAACGTTTAGTGCTC
CAAAATCTGTTTCGATAATGGCAGAGGTTTTTGAAAATCAAGATGTGCTACAAGCACATCTTGATGCTGT
TAAAGATACTATTTCCGCTATTGAAGATCATTACACGCAAACTAGAATCAGTGTTGATGGCACAATTCAA
AAATCAGAGAGTGATAATTTAGTTGTTGCTCTTTTTAATCACAATACTAGTAGAGCATTGGATCCGCAAA
CTCATACACATGCAGTTGTTATGAACATGACTTTAAATGATAAAGATTCATGGACGGCATTAAGTAACGA
AGTAATTTATGATAATCAGGCAACCATAGGTTCGATATATAATTCTAATCTCGCTCAAAATTTAAGAGCT
ATAGGTCTTGATGTAGAGGTAAAAGATAATCAGGGCAATTTTGAAATTGCCGGCTTTACTCCAGAAATGA
TACAAGAGTTTTCTCAGCGAAGAACTCAGATTATTGAAAGTTTAAAAAGTAGAGGAATTGATATTGAAGA
TGCACCTGCTAGTTTGAGAGAACAAGCAGCTTTAAAAACACGGGAAAGGAAACAGGCATTTAATGAGGCT
GAATTACGTCAAGTTTGGAAGGAACGTGCAAGTGAACTTGGCATTACACAAAGTTTTGTAGATAAGCTAG
AAGATAAAATTAAAACGAATCAGATGAATGCGGATCCGCAACCTTCAGAAAAAACCAAAAAGACATATGG
AAAACCGGATCCTCAAAAAATGATCCGAATATATCATTTGAAGGGAAAACGGAAGTTTCTAGCGATAAAT
CTAATAACGCTGATAAAGAAGCACCAGATAAACGAATTGACAACTCTGAAACGCAAAATCCGAGCGATAG
CGCCATTGTCAGGAAAATCCCAAAAAGAGCCAGAAACGCAAAATATGGGCCAAGAAGCGCATATTCAAGA
TGAAGGTAGATTGGGTAAGAAACAAACTGAACCTAAAGCGAGTAACAATTCAAAAGACCAGACTGTACCT
AGAGAACGACCTTATCAAAGAAAGAATCGTGAATCTCAACAAGTACTCATAAGCCAAAAAACAAAAGAAG
CCGTTTACTACGCTATAGGGCATCACACCGAAAGAGAAATGATGATACCTGAAACAAAGATACTAAATAC
GGCTATGAAATTTGACATACAAGAAGTAACTCATGAACAAGTACGAGCTGAGTTAAATAGACTAGAAAAA
GAAAAAATCATTGTCCGGGTAGATGGGAAGTTAACAACTCAGCGTTTGGCACATAGCGAAGTTTGGTCGT
TACAACATATACAAAATGAACAAAAAAGCGTGAGTCCAATAGTGGATGAATCTCAAGTTAAAACAAGACT
CGATCAAGAGGAACAGTTGAGAGGGAGGAAGTTTACACCCGGACAAAGAGCAAGTCTTGAAACAATATTT
AGTTCTGAAAGTAGATATATAGGCGTAGACGGTTTAGCTGGTACGGGTAAAACTACAATGCTGCATACTT
TGAATAAAGTAGCCTCAGAAAACGGTTTTATTGTTAAAGGTATGGCCGCCACTGGCGTAGCTGCTAAAAA
CTTAGAATTGGAAACTGGTATACCCTCAAAAACAATGGCCATGTTTCAGATTAAAGAAAATGAGCTTCAG
AAAGAAATTGAAAAGAATGGGGGAGTAAACCGTAAAAATGAAATCTGGATAGTTGATGAATCTTCATTTG
TAAGCCAGACAAACTTCAAAGACATTTTGACTTTGGCTAAGCAAGCTAATAGTCGTGTTGTTTTTTTAGG
GGATAAATTGCAGCTTCAGTCAATTAGTGCAGGAAAACCATTTGAACTTGTACAAAATAGAGGTGTGCTA
AAAACTTCACAAATGCATGACATTATCCGTCAAAAAAAACCAGGAACTTAA
 Primer design