SecReT4
Protein ID: 184160046
T4SS name [ID]Tra_F [523]
Gene symbol-
Locus tagACICU_p0060
StrainAcinetobacter baumannii ACICU
Repliconplasmid pACICU2 [GenBank: NC_010606] [Browse all T4SS(s) in this replicon]
Location [Strand]30845..31981 [+]
ProductTrwC protein
Component typeTraI_F
UniProt IDB2I3X4
KEGG IDabc:ACICU_p0060
PDB IDNA
Domain hit(s) vs Pfam UvrD_C_2 [PF13538], Evalue: 7.5e-07, Aligned region: 213..326
Protein Sequence: 378 a.a.     [Download]
>gi|184160046|ref|YP_001840914.1| TrwC protein [Acinetobacter baumannii ACICU]
MTLSVKKNQELKDVVSVVVAKNKEGKIDLSNNDKAFDLLDKQQRIHEVVVAAKGTQPALHEQHDLFQEIH
EVHQKLVGDYMRLNKESRDNSLIITPFNSDRVMLNSLVRSEMKKLNELDHNDHNFEILVNTNFTEAERKH
INNYEPNMTIRFGKSFTDKDTGIKIEKGDYLKVMMKDKEGKLVLIDKDKNKIKWNPKKGSVEVYKSEQRK
IAKGDVIRITRTKDDEQIKNGERYKIKDIHEDKVIVEGQDGKEKSLSRSGFKHFDYGYSSTVYSSQGLTQ
GNVFLLLNSQKLANDLKSDKAATKVLGNTFGTRSFYVAVTREEHNLQIYTDNKQMTREAITFKQDKTSYL
DTVKEVGQKVPEHIIENEKIGVTNELER
 
Nucleotide Sequence: 1137 bp     [Download]
>gi|184160017|ref|NC_010606.1|:30845-31981 Acinetobacter baumannii ACICU plasmid pACICU2, complete sequence
ATGACATTATCCGTCAAAAAAAACCAGGAACTTAAAGACGTGGTTTCTGTTGTCGTTGCAAAAAACAAAG
AAGGTAAAATTGATTTAAGTAACAACGATAAAGCTTTTGATTTACTTGATAAACAGCAAAGGATTCATGA
AGTAGTTGTAGCTGCAAAGGGTACACAACCAGCTCTACATGAGCAGCATGACTTATTTCAGGAAATTCAT
GAAGTACATCAAAAATTAGTTGGTGATTATATGAGGCTTAATAAGGAATCAAGAGATAATAGCCTTATCA
TTACTCCCTTTAACTCAGATAGAGTAATGCTGAACTCACTTGTAAGAAGCGAAATGAAAAAACTAAATGA
ATTAGATCATAATGATCATAATTTTGAGATCTTAGTAAATACCAATTTCACTGAAGCGGAGCGTAAACAT
ATTAATAATTATGAGCCTAATATGACGATACGTTTTGGGAAATCATTTACAGATAAAGACACAGGAATCA
AAATTGAAAAAGGTGACTATCTAAAAGTAATGATGAAAGACAAAGAAGGTAAATTGGTATTAATTGATAA
GGATAAAAATAAAATTAAATGGAACCCTAAAAAAGGAAGTGTAGAAGTATATAAATCAGAACAAAGAAAG
ATAGCTAAGGGAGATGTAATAAGAATTACCAGGACAAAAGATGATGAACAGATCAAGAATGGTGAAAGAT
ATAAAATCAAGGATATTCATGAAGATAAAGTAATAGTAGAAGGCCAGGATGGGAAAGAGAAAAGCCTATC
AAGAAGTGGGTTTAAACATTTTGATTACGGCTATAGTAGTACTGTTTATTCCTCTCAGGGCTTAACACAG
GGTAATGTATTTTTATTACTAAATAGCCAAAAATTAGCAAATGATCTGAAAAGTGATAAGGCTGCCACCA
AAGTTTTAGGTAATACATTTGGAACAAGATCATTTTATGTTGCTGTAACGAGGGAAGAGCATAATTTGCA
GATTTACACTGATAATAAACAAATGACACGAGAAGCAATTACGTTTAAACAAGATAAAACAAGTTATTTG
GATACAGTTAAAGAAGTTGGTCAAAAAGTACCAGAACATATCATCGAAAATGAAAAAATTGGTGTAACTA
ATGAGCTAGAAAGATAG
 Primer design