SecReT4
Protein ID: 184160056
T4SS name [ID]Tra_F [523]
Gene symbol-
Locus tagACICU_p0070
StrainAcinetobacter baumannii ACICU
Repliconplasmid pACICU2 [GenBank: NC_010606] [Browse all T4SS(s) in this replicon]
Location [Strand]39235..39861 [+]
Productsoluble lytic murein transglycosylase
Component typeOrf169_F
UniProt IDB2I3Y4
KEGG IDabc:ACICU_p0070
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 208 a.a.     [Download]
>gi|184160056|ref|YP_001840924.1| soluble lytic murein transglycosylase [Acinetobacter baumannii ACICU]
MIEAMQRAKTYKIHNSIIKLSAIVFGACVTSTTYAVCWDEAASMYGTDPILLKAIGWKESRGHVGAVGSL
LKDGNRALGLMQINTIHLPALRKQGITRNDLFDPCTSQKIASWVLADCLKKFGEVWRAVGCYYGGPASKA
YTAMNQYSADVRRYFEGYKRKAGLPAVYTPLQPQSIKAQSVNYNEDIPNYSSVNQTIKKTSNFQIIRF
 
Nucleotide Sequence: 627 bp     [Download]
>gi|184160017|ref|NC_010606.1|:39235-39861 Acinetobacter baumannii ACICU plasmid pACICU2, complete sequence
ATGATTGAAGCTATGCAAAGAGCTAAAACTTACAAAATACATAACTCAATTATAAAACTTTCAGCAATCG
TATTTGGAGCTTGTGTTACATCAACAACATATGCTGTTTGTTGGGATGAAGCCGCAAGTATGTATGGTAC
GGATCCTATTTTATTAAAAGCAATTGGATGGAAAGAGAGTAGAGGCCATGTTGGTGCAGTTGGTTCTTTA
CTTAAAGATGGCAATAGAGCATTAGGACTAATGCAGATAAATACCATTCATTTACCAGCTTTAAGAAAAC
AAGGAATTACTCGTAATGATTTATTCGATCCTTGTACTTCTCAAAAAATTGCTTCATGGGTTCTTGCTGA
TTGTTTAAAAAAATTTGGTGAAGTCTGGAGAGCAGTAGGGTGTTACTACGGAGGACCTGCTTCTAAAGCA
TATACGGCAATGAATCAATATTCTGCCGATGTTAGAAGATACTTTGAAGGCTATAAAAGAAAAGCGGGCT
TACCAGCAGTTTATACCCCATTACAACCTCAAAGTATAAAAGCTCAGTCAGTTAATTATAACGAAGATAT
TCCAAATTATTCTTCAGTGAATCAAACAATTAAGAAAACTTCAAATTTCCAAATAATTCGATTCTAA
 Primer design