SecReT4
Protein ID: 184160057
T4SS name [ID]Tra_F [523]
Gene symbol-
Locus tagACICU_p0071
StrainAcinetobacter baumannii ACICU
Repliconplasmid pACICU2 [GenBank: NC_010606] [Browse all T4SS(s) in this replicon]
Location [Strand]40165..40518 [+]
Producthypothetical protein
Component typeTraA_F
UniProt IDB2I3Y5
KEGG IDabc:ACICU_p0071
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 5.9e-05, Aligned region: 18..107
Protein Sequence: 117 a.a.     [Download]
>gi|184160057|ref|YP_001840925.1| hypothetical protein ACICU_p0071 [Acinetobacter baumannii ACICU]
MELVVPAQTHQIYFDIKKLKRPVTIALMVVTAMLIWMTLSTAGTGTGVGSTFNTWATTVEGWIKGPYGKL
AILASLLFAIGAFAWTRDLRVIVIPAVAAVVVGIIVSLVTGSFTAVI
 
Nucleotide Sequence: 354 bp     [Download]
>gi|184160017|ref|NC_010606.1|:40165-40518 Acinetobacter baumannii ACICU plasmid pACICU2, complete sequence
ATGGAATTAGTTGTTCCAGCTCAAACACATCAAATTTACTTTGATATCAAAAAACTAAAACGTCCAGTAA
CAATCGCCTTGATGGTTGTCACAGCAATGCTTATTTGGATGACTTTATCAACCGCAGGTACTGGTACAGG
TGTTGGTTCTACATTTAACACTTGGGCGACAACAGTGGAAGGCTGGATTAAAGGCCCATACGGGAAATTA
GCAATTCTTGCGAGTTTATTATTCGCAATTGGTGCATTCGCTTGGACTCGTGATCTTCGCGTTATTGTAA
TTCCAGCAGTTGCTGCCGTTGTAGTTGGAATTATTGTGTCGTTAGTAACAGGTTCGTTTACAGCCGTTAT
CTAA
 Primer design