SecReT4
Protein ID: 184160058
T4SS name [ID]Tra_F [523]
Gene symbol-
Locus tagACICU_p0072
StrainAcinetobacter baumannii ACICU
Repliconplasmid pACICU2 [GenBank: NC_010606] [Browse all T4SS(s) in this replicon]
Location [Strand]40539..40832 [+]
Producthypothetical protein
Component typeTraL_F
UniProt IDB2I3Y6
KEGG IDabc:ACICU_p0072
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 1.4e-17, Aligned region: 10..96
Protein Sequence: 97 a.a.     [Download]
>gi|184160058|ref|YP_001840926.1| hypothetical protein ACICU_p0072 [Acinetobacter baumannii ACICU]
MSSGVELSHYVPTYIDAKSKFLMFDQDVALASFLIFILGFVFGHPFLGFFVGFAIAYYFNKAKAGLHPDY
MLHLTYWVANSPKLKELPESNNRHFFG
 
Nucleotide Sequence: 294 bp     [Download]
>gi|184160017|ref|NC_010606.1|:40539-40832 Acinetobacter baumannii ACICU plasmid pACICU2, complete sequence
ATGTCTTCAGGTGTAGAACTTTCTCATTATGTTCCAACGTACATCGATGCTAAATCAAAGTTCTTAATGT
TCGATCAAGATGTTGCTTTAGCTTCATTTCTGATCTTCATTCTGGGTTTTGTTTTTGGTCATCCCTTCTT
GGGATTCTTTGTGGGATTCGCAATAGCTTATTACTTCAATAAAGCTAAAGCAGGTCTACATCCTGATTAT
ATGCTCCACCTAACTTACTGGGTGGCTAACTCACCGAAATTAAAGGAGTTGCCTGAATCAAACAATCGCC
ACTTTTTCGGATGA
 Primer design