SecReT4
Protein ID: 184160059
T4SS name [ID]Tra_F [523]
Gene symbol-
Locus tagACICU_p0073
StrainAcinetobacter baumannii ACICU
Repliconplasmid pACICU2 [GenBank: NC_010606] [Browse all T4SS(s) in this replicon]
Location [Strand]40837..41415 [+]
Producthypothetical protein
Component typeTraE_F
UniProt IDB2I3Y7
KEGG IDabc:ACICU_p0073
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 2e-15, Aligned region: 15..188
Protein Sequence: 192 a.a.     [Download]
>gi|184160059|ref|YP_001840927.1| hypothetical protein ACICU_p0073 [Acinetobacter baumannii ACICU]
MDSEVGIASNESLNSRNRSQTYVIFSLIGLLTLSIIANIVLARSGKTIIKPSDNSGPTYILGSTSANKEY
YLDFSNYVINYLFNVTPINVSKNFEKILGITCEPSFPQIQKYLSQSEAQIKREGLTSVWSSSGAFTFQEA
DKAITIEGTRKTYLADRLVSEKSQKIQTKFVMSKGTICLYSLNEVKDEIATQ
 
Nucleotide Sequence: 579 bp     [Download]
>gi|184160017|ref|NC_010606.1|:40837-41415 Acinetobacter baumannii ACICU plasmid pACICU2, complete sequence
ATGGATTCAGAAGTTGGAATAGCATCAAATGAAAGCCTTAATTCAAGAAATAGATCACAGACTTATGTGA
TCTTTTCTTTAATAGGCTTACTTACTTTATCAATAATTGCAAATATTGTACTTGCACGGAGTGGCAAAAC
AATAATTAAACCTTCGGATAATTCAGGCCCAACGTATATCTTAGGAAGTACTTCGGCAAATAAAGAATAT
TATTTAGATTTTTCAAACTATGTAATTAATTATCTATTCAATGTTACACCAATAAATGTATCCAAGAACT
TTGAAAAAATTCTAGGCATTACATGTGAACCATCCTTCCCACAAATTCAAAAATATTTAAGTCAATCTGA
AGCACAAATTAAACGTGAGGGCCTTACCAGTGTGTGGTCATCTTCAGGTGCTTTCACTTTTCAAGAAGCA
GATAAGGCCATAACCATTGAAGGAACAAGGAAAACCTATTTGGCAGATCGTTTAGTCTCTGAAAAATCAC
AAAAGATTCAAACTAAATTTGTGATGAGTAAGGGAACGATATGTCTTTATTCATTAAATGAGGTGAAAGA
TGAAATTGCAACTCAGTAA
 Primer design