SecReT4
Protein ID: 184160060
T4SS name [ID]Tra_F [523]
Gene symbol-
Locus tagACICU_p0074
StrainAcinetobacter baumannii ACICU
Repliconplasmid pACICU2 [GenBank: NC_010606] [Browse all T4SS(s) in this replicon]
Location [Strand]41396..42118 [+]
Producthypothetical protein
Component typeTraK_F
UniProt IDB2I3Y8
KEGG IDabc:ACICU_p0074
PDB IDNA
Domain hit(s) vs Pfam TraK [PF06586], Evalue: 2.6e-36, Aligned region: 8..235
Protein Sequence: 240 a.a.     [Download]
>gi|184160060|ref|YP_001840928.1| hypothetical protein ACICU_p0074 [Acinetobacter baumannii ACICU]
MKLQLSKIALFISSIFLTTSTFAAQHITKADQETVQVTVSNTEPNVLVVDGRRIVNLVPSDVTALDTLPD
KEQGTLYFKISPYFQNTPITLFVTDDEGTRYKLVLQPRSVGAEEVVLVPPKPGAGTSKRSQSYLQQIKEL
MYVMGDDAENPQETLAVDGISRSFVKAEIPLWKESKFVLLRRYDTDGMYGEMYQLTNLTNKTMNLLEQEF
YRKGVSAVSIQNLTLSPGRSTFVYVVRENN
 
Nucleotide Sequence: 723 bp     [Download]
>gi|184160017|ref|NC_010606.1|:41396-42118 Acinetobacter baumannii ACICU plasmid pACICU2, complete sequence
ATGAAATTGCAACTCAGTAAAATTGCATTGTTTATATCTTCTATCTTCCTGACTACATCTACATTTGCGG
CTCAACATATTACTAAAGCTGATCAAGAAACTGTTCAAGTAACTGTGTCGAATACAGAGCCAAATGTGCT
TGTTGTTGATGGAAGACGAATTGTTAATTTAGTGCCATCAGATGTAACAGCTTTGGATACCTTGCCAGAT
AAAGAGCAAGGGACTCTCTATTTTAAAATATCTCCATATTTCCAGAATACACCTATAACTCTATTTGTTA
CTGATGATGAAGGAACCCGTTACAAGCTTGTATTGCAGCCACGTAGCGTTGGGGCCGAAGAGGTTGTATT
AGTTCCGCCAAAACCAGGTGCGGGCACAAGCAAACGATCTCAATCCTATTTACAGCAAATAAAAGAATTG
ATGTATGTCATGGGAGATGATGCCGAAAATCCTCAAGAGACACTTGCCGTAGACGGGATATCCCGTTCGT
TCGTAAAAGCAGAAATCCCTTTGTGGAAAGAGTCTAAATTTGTTTTGTTGCGTCGTTACGATACCGACGG
TATGTATGGCGAAATGTATCAACTAACTAATTTAACAAATAAAACAATGAATTTGTTAGAGCAGGAATTT
TATAGAAAAGGTGTAAGTGCTGTTTCTATTCAAAATTTAACACTAAGCCCTGGCAGATCGACATTTGTTT
ATGTTGTTAGAGAAAATAATTAG
 Primer design