SecReT4
Protein ID: 184160061
T4SS name [ID]Tra_F [523]
Gene symbol-
Locus tagACICU_p0075
StrainAcinetobacter baumannii ACICU
Repliconplasmid pACICU2 [GenBank: NC_010606] [Browse all T4SS(s) in this replicon]
Location [Strand]42128..43444 [+]
ProductTraB pilus assembly family protein
Component typeTraB_F
UniProt IDB2I3Y9
KEGG IDabc:ACICU_p0075
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.4e-36, Aligned region: 216..412
Protein Sequence: 438 a.a.     [Download]
>gi|184160061|ref|YP_001840929.1| TraB pilus assembly family protein [Acinetobacter baumannii ACICU]
MSNDIDLENPNDKLKKKQIKWLAILGTILFIIVAIFLFSGSPPEETNKTQAPENAVNVEKPGDAEEQDKW
RQTAAIDQEAQKKQIDDLTQTVNSQVAQNDALKSELSIMNERISQIANRSESRVVAQPTNTNPPNLGGIA
GTSSAYPNKQGLHGQSILSDPNGTGIDPQTGERIPLPNNIAPVKTFGIIDMNKSIDEQGNTTSTSVKSQR
PEKTTFIPDGSFVRVVMINGVDAPTGGQAQSDPIPVVFQTVGKFDMPNNYKMNIKGCRFVGAAWGELSSE
RVKATIQSGNCIINGQTVPIQIKGQVVGEDGKTGIRGRVVSKQGQILAKAALASAMEAIGGLYGSTVGTA
SQSALGTVRTISGSELKQAAVGGAISGGAEKLSDFYMQRANDLFPVIEVSAGRTLEIVVQQGGTVANQFL
ITKSATPMNQQKRILMDD
 
Nucleotide Sequence: 1317 bp     [Download]
>gi|184160017|ref|NC_010606.1|:42128-43444 Acinetobacter baumannii ACICU plasmid pACICU2, complete sequence
ATGAGTAACGATATCGATTTAGAAAATCCTAATGACAAACTCAAGAAAAAACAAATTAAATGGTTGGCCA
TATTAGGCACAATATTATTCATTATTGTTGCTATTTTCTTGTTTTCTGGAAGTCCACCAGAAGAAACGAA
TAAAACTCAAGCACCTGAAAATGCGGTAAATGTGGAAAAACCGGGTGATGCTGAAGAGCAAGATAAATGG
AGACAAACGGCCGCAATTGATCAAGAAGCTCAAAAAAAGCAAATTGATGATTTAACTCAAACCGTTAACT
CTCAAGTTGCTCAAAATGATGCGTTAAAGTCAGAACTATCAATAATGAACGAGCGTATTAGTCAAATTGC
TAATCGTTCCGAATCAAGAGTGGTAGCACAACCAACAAATACAAATCCACCAAATCTTGGGGGAATAGCT
GGTACATCTTCAGCTTATCCAAATAAACAAGGATTGCATGGACAAAGTATTCTATCAGATCCAAATGGAA
CTGGTATCGATCCTCAGACAGGCGAGCGAATACCTTTACCAAATAATATAGCTCCAGTTAAAACCTTTGG
CATTATTGACATGAATAAGTCAATTGATGAACAAGGAAATACAACATCTACTTCAGTTAAAAGCCAACGA
CCTGAGAAAACAACATTTATCCCGGATGGGAGTTTTGTTCGTGTCGTAATGATTAATGGCGTAGATGCAC
CAACTGGTGGACAAGCACAGTCGGACCCAATTCCAGTTGTATTCCAAACAGTTGGGAAATTCGATATGCC
AAATAATTATAAAATGAACATCAAAGGATGTCGTTTTGTAGGAGCCGCTTGGGGTGAATTATCGAGTGAA
CGTGTTAAAGCAACAATTCAAAGTGGTAACTGCATTATTAATGGTCAAACAGTACCAATTCAAATTAAAG
GTCAAGTCGTTGGAGAAGACGGCAAAACTGGTATTCGTGGCCGTGTAGTAAGTAAACAAGGTCAAATTCT
TGCTAAAGCTGCATTAGCATCCGCAATGGAGGCTATAGGTGGACTGTACGGTAGTACAGTTGGTACAGCA
AGCCAATCGGCGCTAGGTACTGTTAGAACGATTTCAGGAAGTGAACTGAAGCAAGCCGCAGTAGGTGGTG
CGATTTCAGGTGGAGCAGAAAAACTTTCTGATTTCTATATGCAACGGGCAAATGACTTATTTCCTGTTAT
TGAAGTTAGTGCAGGGCGAACTTTAGAGATTGTTGTTCAACAAGGTGGCACAGTAGCGAATCAATTTTTG
ATAACTAAAAGTGCAACTCCAATGAATCAACAAAAACGCATTTTAATGGATGACTAA
 Primer design