SecReT4
Protein ID: 184160063
T4SS name [ID]Tra_F [523]
Gene symbol-
Locus tagACICU_p0077
StrainAcinetobacter baumannii ACICU
Repliconplasmid pACICU2 [GenBank: NC_010606] [Browse all T4SS(s) in this replicon]
Location [Strand]44470..45114 [+]
Productmembrane lipoprotein lipid attachment site
Component typeTraV_F
UniProt IDB2I3Z1
KEGG IDabc:ACICU_p0077
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 8.4e-17, Aligned region: 30..134
Protein Sequence: 214 a.a.     [Download]
>gi|184160063|ref|YP_001840931.1| membrane lipoprotein lipid attachment site [Acinetobacter baumannii ACICU]
MKRKGILLCLAINLSGCAAFNGGFDGLNGQSSFSCKAPDGILCDSMSGVMANLNANNLPSQQVKHGNSKE
VIANTYMQRTRATKDNAMPVAPYADEPLLRQPKTLRIWVAPWESSDRTLFDQQYFYLVIDNWKWMIEHNS
RRLQDAYAPIGAPISNYSSPAITVADPQSTKTGSDGPIPVNASVNSQPNSKEILNGINTEIKDLNVDISK
FTRQ
 
Nucleotide Sequence: 645 bp     [Download]
>gi|184160017|ref|NC_010606.1|:44470-45114 Acinetobacter baumannii ACICU plasmid pACICU2, complete sequence
ATGAAAAGAAAAGGTATTTTACTTTGCTTGGCAATCAATCTAAGTGGATGTGCAGCATTTAACGGAGGGT
TCGACGGTTTAAATGGTCAAAGCTCATTTTCATGCAAAGCGCCAGATGGAATTTTGTGTGACTCAATGTC
AGGTGTAATGGCGAATTTGAATGCAAACAATTTGCCGTCACAGCAGGTTAAACATGGCAATAGTAAAGAA
GTAATTGCAAATACATATATGCAGCGTACACGTGCGACTAAAGATAATGCAATGCCAGTAGCTCCATACG
CAGATGAACCATTACTACGCCAACCGAAAACTCTCAGAATTTGGGTAGCTCCGTGGGAATCTTCGGATAG
AACTTTATTCGATCAACAATATTTCTATCTAGTAATCGACAATTGGAAGTGGATGATTGAACACAATTCT
CGACGTCTACAAGATGCATACGCACCAATTGGAGCCCCAATTTCAAACTATTCAAGTCCAGCCATTACAG
TTGCGGATCCGCAATCTACTAAAACAGGTTCAGATGGTCCTATACCAGTAAATGCTTCAGTTAATAGCCA
GCCAAATAGTAAAGAAATTTTGAATGGAATAAATACTGAAATAAAAGACTTGAATGTCGATATCTCTAAG
TTTACTAGACAGTGA
 Primer design