SecReT4
Protein ID: 184160064
T4SS name [ID]Tra_F [523]
Gene symbol-
Locus tagACICU_p0078
StrainAcinetobacter baumannii ACICU
Repliconplasmid pACICU2 [GenBank: NC_010606] [Browse all T4SS(s) in this replicon]
Location [Strand]45124..47850 [+]
ProductType IV secretory pathway, VirB4 component
Component typeTraC_F
UniProt IDB2I3Z2
KEGG IDabc:ACICU_p0078
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 8.2e-54, Aligned region: 523..821
TraC_F_IV [PF11130], Evalue: 1.1e-24, Aligned region: 50..324
Protein Sequence: 908 a.a.     [Download]
>gi|184160064|ref|YP_001840932.1| Type IV secretory pathway, VirB4 component [Acinetobacter baumannii ACICU]
MTGNNKLINFRAMLANWFKVHVLGDDPTGKKFSTVDLTNKILESYGMYQIFKYNMFNVKRSLYYNDGPSV
SFALEIIPQTGSNEDFVSRIVSIISSFPAETGIQILNFGNTIFEDDLQEYLDLRVAEYQNGKVSDFAIEF
AKNRIKHIQSRKGRPQFGRDSYYVIKKPKIILSVTRSGSYKDPQLIKQMEELLHQTSAQLQQAKLPNIVL
TPMLLLKIIKPMLDPESLFRTVPPEHEFQVSRSYYSEDYNRLESIKSQLTPRGHSATVGVSEIVFGQPII
DKTKGTNRSVRVYDSEWIEEDDDEDLEEDNRIAFRGFGVMRYPKFKHLYEMGNVIGDFFENSLQYPCPYI
ISMGIHILDKTSSETKARIKQARSTQNAESKMAKWQPEYAEIARDWNAITYHLHKGGGMCELYHTIGIFA
PRSQLDSYSANVDNLWKSNGFSVMPLSCLQLPLLYSSMPMILTKKARDDLKKLKLITTKTTINAVDMMPI
LSEWQGFGKPVIMVFGRRGTPCFFDLFSNKQGNYNFYICGTSGAGKSVFSLEILAAYKSLGFKIYIIDVG
RSFKNFVALGKGQAIDFAKREKICMNPFTWLEVIEDEELSEKEGTLNTFAQEMKMLLPMYAKMASPSKPL
DDYDKALLSRAIRETWLKFRNNNGVDQISDFLKEIRDQNGNIDARGWALGTQLENFKTNGMYGSYFNGKA
NIDMNNEMIYLELEELKDSPELKTVVLFGVMNRIMRDMYLSRSQGKIVFVDEAWQLLDDTEETAAFIEEG
YRRARKYFGSFGMGTQGIDDAFANDAARAAYNSSDWKFFLRQDEQSFEKLLQEKKANFSEAVIKQIKSIE
SIHGWYSEIMVTSPNGQHIVRHVADPFSLAMASTNKDDYNFIEECTNKGMSMTEATYALMRKKEAEEV
 
Nucleotide Sequence: 2727 bp     [Download]
>gi|184160017|ref|NC_010606.1|:45124-47850 Acinetobacter baumannii ACICU plasmid pACICU2, complete sequence
ATGACTGGAAATAACAAACTAATCAATTTTAGAGCCATGCTCGCAAACTGGTTTAAGGTCCACGTATTAG
GTGATGATCCGACAGGTAAAAAATTCTCAACTGTAGATTTAACGAATAAGATTCTTGAAAGCTACGGCAT
GTATCAGATATTTAAATACAACATGTTTAATGTGAAAAGAAGTCTTTATTATAATGATGGCCCTTCCGTA
AGCTTTGCTCTAGAAATCATACCGCAGACAGGATCAAATGAGGACTTCGTTTCTCGCATAGTATCTATTA
TTTCAAGTTTCCCTGCGGAAACAGGTATTCAGATATTAAACTTCGGTAATACAATTTTTGAAGATGATCT
TCAAGAGTACTTGGATTTACGTGTTGCGGAATATCAGAATGGTAAAGTGTCTGATTTCGCAATAGAATTT
GCAAAGAATCGAATCAAACATATCCAGTCTCGTAAAGGACGGCCACAGTTCGGAAGAGACTCATATTACG
TTATTAAAAAACCAAAAATTATTCTATCAGTTACACGTTCGGGTAGTTATAAAGACCCACAACTAATTAA
GCAAATGGAAGAGTTGTTGCATCAGACAAGTGCTCAACTACAACAAGCTAAATTACCTAATATTGTTTTA
ACACCAATGTTACTGCTTAAAATAATTAAGCCAATGCTTGACCCTGAGAGTTTATTTAGAACCGTTCCAC
CAGAACATGAATTCCAAGTTTCTCGCTCATACTACAGTGAAGATTATAATCGTCTAGAATCAATAAAAAG
TCAGTTAACACCACGTGGTCATTCAGCAACAGTTGGTGTGTCTGAAATAGTATTTGGTCAACCTATAATT
GATAAAACTAAGGGAACTAATAGATCAGTAAGAGTCTATGATTCTGAATGGATTGAAGAAGATGACGATG
AAGATCTAGAAGAAGACAATCGAATTGCATTTCGTGGTTTTGGAGTTATGAGGTATCCAAAATTCAAACA
TCTTTATGAAATGGGAAATGTAATTGGCGATTTTTTTGAAAATTCCCTTCAGTATCCATGCCCTTACATA
ATTTCGATGGGTATTCATATCTTAGATAAAACATCTTCTGAAACCAAAGCAAGAATAAAGCAAGCTCGTT
CAACACAGAATGCTGAAAGTAAAATGGCAAAATGGCAGCCTGAGTATGCTGAAATTGCTAGAGATTGGAA
TGCGATCACATATCACCTACATAAAGGTGGAGGGATGTGCGAGCTCTATCATACAATCGGGATATTCGCT
CCAAGATCACAACTAGATAGTTATTCTGCAAACGTTGACAATTTATGGAAGTCAAACGGCTTTAGCGTAA
TGCCGTTATCTTGCTTACAACTGCCACTTCTTTATTCATCAATGCCTATGATTTTGACAAAAAAGGCAAG
AGATGATTTGAAGAAATTAAAGCTGATTACGACTAAAACAACTATTAATGCCGTAGATATGATGCCAATT
TTGTCAGAATGGCAAGGTTTCGGTAAACCGGTAATTATGGTATTTGGCCGCAGAGGAACACCTTGTTTTT
TTGATTTATTTTCAAATAAACAGGGGAACTATAATTTTTATATTTGTGGTACGTCAGGCGCTGGTAAATC
TGTTTTCTCTCTTGAAATTTTGGCAGCTTACAAAAGCTTGGGCTTCAAAATATATATTATTGACGTAGGA
CGCTCATTTAAAAACTTCGTAGCGCTCGGTAAAGGACAAGCAATTGATTTCGCAAAGCGCGAAAAGATTT
GTATGAATCCTTTCACATGGCTAGAGGTAATTGAAGATGAGGAACTTTCGGAAAAAGAAGGAACCTTAAA
TACATTTGCCCAAGAGATGAAAATGCTCTTGCCTATGTATGCAAAAATGGCTTCACCATCCAAACCATTA
GACGATTACGATAAAGCTCTCCTTTCAAGAGCTATTAGAGAGACATGGTTAAAATTCCGCAATAACAATG
GCGTAGACCAAATCTCTGACTTCTTGAAAGAAATTAGAGATCAAAACGGAAATATTGATGCACGAGGTTG
GGCTCTTGGTACTCAGTTAGAAAATTTCAAAACAAACGGGATGTATGGAAGTTACTTTAATGGTAAAGCC
AACATCGATATGAATAACGAGATGATATATCTCGAACTGGAAGAACTAAAAGACTCACCTGAATTAAAAA
CGGTTGTGCTTTTCGGTGTTATGAACCGAATCATGCGAGATATGTATTTATCGCGATCTCAAGGGAAAAT
CGTGTTTGTAGATGAAGCATGGCAACTACTTGATGATACAGAAGAAACAGCAGCTTTTATTGAAGAAGGT
TATCGTAGAGCACGTAAATACTTTGGTTCATTTGGCATGGGTACTCAAGGTATTGATGACGCATTTGCGA
ATGATGCTGCTAGAGCTGCATATAATTCTTCAGACTGGAAATTCTTCTTACGCCAAGATGAACAAAGCTT
TGAAAAGTTACTTCAAGAGAAAAAAGCGAACTTTTCTGAAGCTGTCATTAAACAAATTAAGTCAATTGAA
AGTATCCACGGTTGGTATTCAGAAATTATGGTTACTTCACCAAACGGTCAGCACATCGTAAGACATGTTG
CGGATCCGTTTTCTTTAGCTATGGCATCAACAAACAAAGACGACTACAACTTCATTGAAGAATGCACGAA
TAAAGGCATGAGTATGACAGAAGCAACATACGCTTTAATGCGTAAAAAAGAGGCTGAAGAAGTATGA
 Primer design