SecReT4
Protein ID: 184160066
T4SS name [ID]Tra_F [523]
Gene symbol-
Locus tagACICU_p0080
StrainAcinetobacter baumannii ACICU
Repliconplasmid pACICU2 [GenBank: NC_010606] [Browse all T4SS(s) in this replicon]
Location [Strand]48777..49415 [+]
Producthypothetical protein
Component typeTraW_F
UniProt IDB2I3Z4
KEGG IDabc:ACICU_p0080
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 212 a.a.     [Download]
>gi|184160066|ref|YP_001840934.1| hypothetical protein ACICU_p0080 [Acinetobacter baumannii ACICU]
MKFSKYLFLLPILAISFNSNSKDLGVNGAVYKIQEPDALEQIYTKLKALEKTGELKRKQQEAVSRAMNSA
KNPKPVENISTVTVKKVRLFDPTMHLSNDIKTDEGVVVARAGTSVNPLDTVTMTKTLVLFKGSDPEQVQA
VKKLTELYKNRITPILVDGSWFDLTRAWKRQVYFDQYGYISKRLQITSVPSIVRQNGKMLEISEVPAKEL
VK
 
Nucleotide Sequence: 639 bp     [Download]
>gi|184160017|ref|NC_010606.1|:48777-49415 Acinetobacter baumannii ACICU plasmid pACICU2, complete sequence
ATGAAATTTTCTAAATATCTTTTTTTATTACCAATTTTAGCGATTTCATTTAACTCTAATTCCAAAGATT
TAGGGGTTAATGGAGCTGTATATAAAATTCAAGAGCCGGATGCATTAGAGCAAATTTATACGAAATTAAA
GGCTCTTGAGAAAACCGGTGAGTTAAAGCGGAAACAGCAAGAAGCTGTTTCACGTGCCATGAACTCTGCT
AAAAACCCAAAACCAGTTGAAAATATTTCTACTGTTACAGTAAAGAAGGTCAGGTTATTTGACCCAACCA
TGCACTTATCTAATGACATAAAAACTGATGAAGGGGTTGTGGTTGCTAGAGCAGGAACAAGTGTAAATCC
ATTGGATACCGTGACCATGACTAAAACACTAGTTCTTTTTAAAGGCTCAGATCCAGAACAAGTACAAGCG
GTAAAAAAATTAACTGAATTGTATAAAAATCGAATTACTCCAATTTTAGTAGATGGCTCTTGGTTCGATT
TGACTAGAGCTTGGAAACGTCAAGTCTACTTTGACCAGTACGGTTATATCTCAAAGCGATTACAAATTAC
ATCTGTACCATCGATTGTTAGACAAAATGGAAAAATGCTTGAGATTAGTGAAGTCCCAGCTAAGGAGTTA
GTGAAATGA
 Primer design