SecReT4
Protein ID: 184160067
T4SS name [ID]Tra_F [523]
Gene symbol-
Locus tagACICU_p0081
StrainAcinetobacter baumannii ACICU
Repliconplasmid pACICU2 [GenBank: NC_010606] [Browse all T4SS(s) in this replicon]
Location [Strand]49412..50455 [+]
ProductTraU family protein
Component typeTraU_F
UniProt IDB2I3Z5
KEGG IDabc:ACICU_p0081
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 1e-75, Aligned region: 37..337
Protein Sequence: 347 a.a.     [Download]
>gi|184160067|ref|YP_001840935.1| TraU family protein [Acinetobacter baumannii ACICU]
MKKFFTILFLLIFTNLSFAADSGSNNNGSKSLRCPGEFANPISDICWSCIFPISMGGMPLWKGGQEDNSN
PSQLFCSCAIPRIYLGIQTGFWEPVRRVDVTRTPYCMVSLGTELDVGVEAPEGEVRLHDDNNRHSFYQAH
WYTDPIMMWLEVIYEHPCTETGYFDIGYMTELDPMWNDDELSAILSPEAALFTNPLTQAACAGDCVLASA
GFGSNGLFWCAGCNGSIYPLNGNVGAHVSHIQASSLIAQRLAAKMHRQFLTWGTNGEAGLCGVYPQPIMD
KTAYKYQMLYPVAQTKKINGKCCQPFGRTTSVWGAGKSWPVTGEHFSYELFRKKNCCLGPISPFYVY
 
Nucleotide Sequence: 1044 bp     [Download]
>gi|184160017|ref|NC_010606.1|:49412-50455 Acinetobacter baumannii ACICU plasmid pACICU2, complete sequence
ATGAAGAAATTTTTTACTATTTTATTCCTTTTAATTTTCACTAATTTAAGCTTCGCCGCTGACTCTGGAT
CAAATAATAATGGATCTAAAAGCTTACGTTGCCCAGGCGAATTTGCTAATCCAATTAGCGATATCTGTTG
GTCTTGCATTTTTCCTATCAGCATGGGAGGAATGCCATTGTGGAAAGGTGGACAAGAAGATAATAGTAAT
CCATCGCAATTGTTCTGTAGTTGTGCGATCCCAAGAATCTATCTAGGAATTCAAACAGGTTTTTGGGAGC
CAGTAAGACGAGTAGATGTAACTCGTACTCCTTATTGTATGGTTTCATTAGGAACTGAATTGGACGTAGG
TGTAGAAGCACCGGAAGGTGAAGTACGTTTGCATGATGACAACAATAGGCACTCATTTTATCAAGCGCAC
TGGTATACAGATCCAATCATGATGTGGTTAGAAGTGATCTATGAGCATCCATGTACTGAAACTGGATACT
TTGATATCGGATATATGACTGAGTTGGATCCGATGTGGAATGATGATGAGTTGTCTGCAATTTTATCTCC
AGAAGCAGCCTTATTCACAAACCCACTTACACAAGCTGCATGTGCAGGGGATTGCGTATTAGCATCAGCA
GGTTTTGGTTCAAATGGTCTGTTCTGGTGTGCTGGATGTAATGGTTCAATTTATCCATTAAATGGGAACG
TTGGCGCACATGTTAGTCATATTCAAGCTTCATCACTAATTGCACAACGATTAGCAGCAAAAATGCATCG
TCAGTTCCTAACTTGGGGAACCAATGGAGAAGCTGGATTGTGTGGCGTTTATCCGCAACCAATTATGGAT
AAAACAGCATATAAATATCAGATGCTCTATCCAGTGGCACAAACTAAAAAAATTAATGGTAAATGCTGTC
AGCCATTCGGCAGAACGACAAGTGTATGGGGTGCCGGGAAATCATGGCCGGTAACTGGCGAACATTTCTC
ATATGAATTATTCAGAAAGAAAAATTGCTGTTTGGGCCCTATTTCACCGTTCTATGTGTATTAA
 Primer design