SecReT4
Protein ID: 184160068
T4SS name [ID]Tra_F [523]
Gene symbol-
Locus tagACICU_p0082
StrainAcinetobacter baumannii ACICU
Repliconplasmid pACICU2 [GenBank: NC_010606] [Browse all T4SS(s) in this replicon]
Location [Strand]50470..51177 [+]
Producthypothetical protein
Component typeTrbC_F
UniProt IDB2I3Z6
KEGG IDabc:ACICU_p0082
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 5.7e-32, Aligned region: 103..211
Protein Sequence: 235 a.a.     [Download]
>gi|184160068|ref|YP_001840936.1| hypothetical protein ACICU_p0082 [Acinetobacter baumannii ACICU]
MKKLILASICLLSCNVHSADFPSEQEIKKEMDKVKNQTFKKSDWEMAQEKARKQIEIFKSVEARPNNFPN
INVQKPNGINLDDIAARYKRKAENKKNVDGILAFASLSMPKDALNKLVTDVTKAGGVVVFRGFKDGNYME
MAKAISQIGVKSANIQINPNAFKQYRVDSVPAIVLVKPRAEENLDEEGCVLPENHSKITGDISLEYALEQ
MEKKETAELSQIAKRYLTFLKGANQ
 
Nucleotide Sequence: 708 bp     [Download]
>gi|184160017|ref|NC_010606.1|:50470-51177 Acinetobacter baumannii ACICU plasmid pACICU2, complete sequence
ATGAAAAAATTAATCCTAGCATCAATTTGTTTGTTGTCTTGCAATGTACACAGTGCAGATTTTCCTAGCG
AACAAGAAATTAAAAAGGAAATGGATAAAGTAAAAAATCAGACTTTCAAAAAGTCTGATTGGGAAATGGC
TCAAGAAAAAGCAAGAAAGCAAATTGAAATTTTTAAAAGTGTTGAGGCACGTCCTAACAACTTTCCAAAT
ATTAATGTTCAAAAACCAAATGGTATAAATCTTGATGACATTGCAGCAAGATATAAACGTAAAGCAGAAA
ATAAGAAAAATGTTGATGGTATTTTAGCTTTTGCAAGCTTATCTATGCCCAAAGATGCTTTAAACAAACT
AGTGACAGATGTTACTAAGGCTGGTGGCGTAGTTGTCTTTAGAGGTTTTAAAGACGGTAACTACATGGAA
ATGGCGAAAGCCATATCCCAGATAGGCGTTAAATCAGCCAATATTCAAATTAACCCTAACGCGTTTAAAC
AATACCGGGTTGATTCAGTACCGGCTATAGTTTTAGTAAAACCACGGGCAGAAGAAAATCTAGATGAAGA
AGGCTGTGTATTACCCGAAAATCATAGCAAAATTACGGGTGATATAAGTCTTGAATATGCCTTAGAACAA
ATGGAGAAAAAAGAAACGGCTGAATTGAGTCAGATCGCAAAGAGATATCTGACCTTTTTAAAAGGAGCTA
ATCAATGA
 Primer design