SecReT4
Protein ID: 184160069
T4SS name [ID]Tra_F [523]
Gene symbol-
Locus tagACICU_p0083
StrainAcinetobacter baumannii ACICU
Repliconplasmid pACICU2 [GenBank: NC_010606] [Browse all T4SS(s) in this replicon]
Location [Strand]51223..51882 [+]
Producthypothetical protein
Component typeTraN_F
UniProt IDB2I3Z7
KEGG IDabc:ACICU_p0083
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 219 a.a.     [Download]
>gi|184160069|ref|YP_001840937.1| hypothetical protein ACICU_p0083 [Acinetobacter baumannii ACICU]
MSSVIHAKTAEEEGRDFGQNSIESTSSLVNSQNGQNTVPNFSTNAPESAYYQNGMGNVNSIGNQKVTNCQ
NQNMSGSNQLNLECEAINLVNKSATSRPIYEIDPKKDPLVKDSKETIKVSGESATQASIEGSTNQFCFNK
EFDVKPVFENKQCSVFSTSSTESCINKILFTDCISPIKDMICGEDGSGIDHTTLKVTKPFHNSTITMENG
FLKIWPIWN
 
Nucleotide Sequence: 660 bp     [Download]
>gi|184160017|ref|NC_010606.1|:51223-51882 Acinetobacter baumannii ACICU plasmid pACICU2, complete sequence
ATGTCAAGCGTCATACATGCAAAAACAGCAGAAGAGGAAGGGAGAGATTTTGGCCAAAATTCTATTGAGT
CCACATCCTCTTTAGTAAATTCTCAAAATGGTCAGAATACAGTACCAAATTTTTCAACTAACGCACCTGA
ATCCGCCTATTATCAAAATGGAATGGGAAACGTTAATAGTATTGGAAACCAGAAAGTTACGAACTGCCAA
AACCAAAATATGAGTGGAAGCAATCAACTTAACTTGGAATGTGAGGCTATTAATTTAGTTAATAAGAGTG
CTACATCTAGACCAATTTATGAAATTGATCCAAAAAAAGATCCCCTAGTAAAAGACTCTAAGGAAACTAT
AAAGGTATCTGGTGAAAGTGCTACACAAGCAAGCATTGAAGGTTCTACAAATCAGTTTTGTTTCAATAAA
GAATTCGATGTTAAACCAGTTTTTGAAAATAAACAGTGCTCAGTATTTTCAACTAGTTCTACAGAAAGCT
GCATAAACAAAATTCTCTTTACTGATTGTATTTCTCCAATAAAAGACATGATTTGTGGAGAAGATGGAAG
CGGAATTGATCATACTACTTTAAAAGTGACTAAACCATTTCATAATTCAACAATCACAATGGAAAATGGC
TTTTTAAAAATTTGGCCTATTTGGAACTGA
 Primer design