SecReT4
Protein ID: 184160071
T4SS name [ID]Tra_F [523]
Gene symbol-
Locus tagACICU_p0085
StrainAcinetobacter baumannii ACICU
Repliconplasmid pACICU2 [GenBank: NC_010606] [Browse all T4SS(s) in this replicon]
Location [Strand]53250..54038 [+]
Producthypothetical protein
Component typeTraF_F
UniProt IDB2I3Z9
KEGG IDabc:ACICU_p0085
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 7.7e-71, Aligned region: 30..251
Thioredoxin_2 [PF13098], Evalue: 4.4e-07, Aligned region: 159..232
Redoxin [PF08534], Evalue: 8.5e-05, Aligned region: 151..229
Thioredoxin_8 [PF13905], Evalue: 9.8e-05, Aligned region: 160..196
Protein Sequence: 262 a.a.     [Download]
>gi|184160071|ref|YP_001840939.1| hypothetical protein ACICU_p0085 [Acinetobacter baumannii ACICU]
MVVFSGLTQLTKANNVLDYDSVWNCDRTKVNWYCNKPKEETPVQEVKKETPKQAPLFDPITDLNKLKTAT
ELRAELKKREDIAVMYPTEQNIKNYLDAWHLVQNKATVFTDQWRRVVYQNPDYDYSLRNPSNNAAIKVQA
QAKQTQIDGYLKNLSKEQGLIFFFRSDCPYCHQMAPILKQLSQMYGFEVLGVSVDGAGLPDFPNPVDGRA
VVQKWGIEKVPATFIASKKTKDHAPIGFGVMSLNEVIERIWVLTNTQPGQDF
 
Nucleotide Sequence: 789 bp     [Download]
>gi|184160017|ref|NC_010606.1|:53250-54038 Acinetobacter baumannii ACICU plasmid pACICU2, complete sequence
ATGGTTGTATTTAGTGGGCTAACTCAGCTAACAAAAGCCAATAATGTATTGGATTATGACTCTGTTTGGA
ATTGTGATCGAACTAAAGTCAACTGGTATTGTAATAAGCCAAAAGAAGAAACGCCGGTTCAGGAAGTAAA
AAAGGAAACTCCTAAACAAGCTCCTTTATTTGATCCTATTACTGATTTAAATAAATTAAAGACTGCGACT
GAACTTCGAGCTGAGTTAAAAAAACGAGAAGATATAGCAGTCATGTATCCGACAGAACAGAACATCAAAA
ATTATCTTGATGCATGGCATCTTGTACAAAACAAAGCAACTGTATTTACAGACCAATGGAGACGAGTAGT
TTATCAGAATCCAGACTATGATTATTCATTAAGAAACCCATCTAATAATGCAGCGATTAAAGTTCAAGCA
CAGGCAAAGCAAACGCAAATTGATGGATATCTTAAGAACTTAAGTAAAGAACAAGGATTGATATTCTTCT
TCAGATCAGACTGTCCGTACTGTCATCAAATGGCTCCAATACTTAAACAATTATCACAAATGTATGGTTT
TGAAGTGCTTGGCGTTAGTGTTGATGGAGCTGGATTACCTGACTTTCCAAATCCTGTAGATGGCCGTGCA
GTGGTACAAAAATGGGGTATTGAAAAAGTACCCGCTACCTTTATTGCATCTAAAAAAACTAAAGATCACG
CACCGATTGGATTTGGTGTAATGTCTTTAAATGAAGTCATAGAAAGAATTTGGGTACTTACAAATACCCA
ACCAGGTCAAGATTTTTAA
 Primer design