SecReT4
Protein ID: 184160073
T4SS name [ID]Tra_F [523]
Gene symbol-
Locus tagACICU_p0087
StrainAcinetobacter baumannii ACICU
Repliconplasmid pACICU2 [GenBank: NC_010606] [Browse all T4SS(s) in this replicon]
Location [Strand]54440..54976 [+]
ProductTraH family protein
Component typeTraH_F
UniProt IDB2I401
KEGG IDabc:ACICU_p0087
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 1.3e-61, Aligned region: 25..171
Protein Sequence: 178 a.a.     [Download]
>gi|184160073|ref|YP_001840941.1| TraH family protein [Acinetobacter baumannii ACICU]
MKIKALIIGVLFGITVSANADPASMQEVFDQINARGNVTQPTAIQGQTMNYMTGGSLFMRTPNTTYNLAA
ITPPSANAGCGGIDLYMGGFSFVNKEQFVAMLKNIGSNALGYGFKLALQNLCPTCDNVLQALQSASQQIN
RMNIDSCEAAKGIVNAATSTVALRGREQSSMNFGTIKK
 
Nucleotide Sequence: 537 bp     [Download]
>gi|184160017|ref|NC_010606.1|:54440-54976 Acinetobacter baumannii ACICU plasmid pACICU2, complete sequence
ATGAAAATTAAAGCATTAATTATAGGTGTTCTATTTGGTATTACGGTTTCTGCAAATGCCGATCCAGCCT
CAATGCAAGAAGTTTTTGACCAAATAAATGCGCGTGGAAATGTTACTCAGCCAACCGCAATCCAGGGCCA
GACTATGAATTATATGACAGGTGGGAGTTTGTTTATGCGAACTCCCAACACCACATATAATCTAGCTGCT
ATTACCCCTCCTTCAGCTAATGCTGGTTGTGGCGGCATTGACTTGTATATGGGTGGCTTCAGCTTTGTAA
ATAAAGAACAATTTGTAGCCATGCTAAAAAATATCGGCTCAAATGCATTGGGATATGGCTTTAAATTAGC
TTTACAAAATTTATGTCCGACTTGCGATAACGTTCTGCAAGCTCTTCAATCTGCCTCTCAACAAATTAAT
AGAATGAACATTGATTCGTGTGAGGCAGCGAAAGGGATTGTTAATGCAGCAACTTCTACTGTTGCATTGC
GTGGACGCGAACAATCTTCAATGAATTTTGGAACAATAAAAAAATAA
 Primer design