SecReT4
Protein ID: 184160075
T4SS name [ID]Tra_F [523]
Gene symbol-
Locus tagACICU_p0089
StrainAcinetobacter baumannii ACICU
Repliconplasmid pACICU2 [GenBank: NC_010606] [Browse all T4SS(s) in this replicon]
Location [Strand]55885..58887 [+]
ProductTraG domain-containing protein
Component typeTraG_F
UniProt IDB2I403
KEGG IDabc:ACICU_p0089
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 4.4e-72, Aligned region: 7..465
Protein Sequence: 1000 a.a.     [Download]
>gi|184160075|ref|YP_001840943.1| TraG domain-containing protein [Acinetobacter baumannii ACICU]
MDFTIETYWNVESTYLILNAVASLMGSSDWVGALKFIFLTAIMASLFVFALDRDLGKFVRNFGWAYFIVV
IIMAPVSSVAVVDKLKQEPPKIVGNVPWLLAMGAFTTNFTTGWITKEYETLTSVPSSLSLTGTGDMGFGQ
ALIRNTNKMSITSPSLRADIMQYIKECSIYDMQDGVLNAEDLMQKTDSWNKLFSNTNPARFVTLGILKGA
PETVTCVEGATRLKQQVNDGIAAAMRYYGKNAFIDFNEATALSMYTNAVGTSYSWILGANQSASDAVKQS
MFNNIMKDANTELPALINDQTRIQELMASAGAAAASEQMKGAAAVLSKLAFEVIPIVRNWLEVVLYATFP
IAVMLIVLKPSTAVNILSGYFTSFLTLGLFPLIFALINHASMLYLRRKAEALDFSEGIPFTKMGVLDSTV
VDIQTVIGLFVILTIPLAAWIARGFYGDIAAIGNQIVGRFTSAGSSIGSSMAMGNMTLGETNIDSSSVNN
TSMNKYDSNLSQSRGLTTLTNEYGTSHTLTPSGVMNTQKLEDTTAQSLHTGQSISRSNENRYGQSTDSVY
GVGATYDTATGSTNTNSYNRSETYGLTDERGVSNSSVTGVGNSKGYTTGTNQNESDTTHTGVSLSKTDYT
AMSAGANGNLGLGGGAGSGGGGSEEKRVAGSPTNPGNVQPESKGEGGKGGKGGKAGVGIQAGVGVYAQGQ
KGINWSGTQDEGQNRTSAVDEYRGVSTGVNYRNDLEHNKHESQNETHTSSNGHERSASLYENNSYAENRN
AQLSSRNEEARSTSFASSHSMESGYNYAQDPKFKKEVAQHFGLDQVQFSNLSPQQQTQYMQDYLANETAR
IKETPSTYADGKPIEFNLPSDFRSNKGNVGSRSGISADFAENSSNIGTGIKQVSVNTGPSSAISGVKNSL
DDIEGNMSVIQQNQHNKTEHTKDRNFELEEKVGEWKRKDIKDTIDFDPIGHAKEAFTELKEKVMPKNETH
INSNGASFGQWNRRDIDPKK
 
Nucleotide Sequence: 3003 bp     [Download]
>gi|184160017|ref|NC_010606.1|:55885-58887 Acinetobacter baumannii ACICU plasmid pACICU2, complete sequence
ATGGACTTTACAATTGAAACGTACTGGAACGTTGAAAGTACCTACTTAATCCTTAATGCTGTTGCATCTC
TCATGGGAAGTAGCGACTGGGTAGGGGCTTTAAAATTCATCTTTTTAACTGCGATCATGGCTTCGCTTTT
TGTATTTGCTTTAGATAGAGATTTAGGAAAGTTTGTTAGAAATTTTGGTTGGGCTTACTTTATTGTAGTA
ATCATTATGGCGCCGGTTAGTTCAGTGGCCGTAGTTGATAAACTTAAGCAAGAGCCACCAAAAATTGTGG
GTAATGTTCCCTGGCTGTTAGCAATGGGAGCATTCACAACAAATTTCACAACGGGATGGATAACTAAAGA
ATATGAAACACTTACTTCCGTACCTAGCAGCCTAAGTTTAACAGGAACTGGTGATATGGGCTTTGGTCAA
GCCCTAATAAGAAACACAAATAAAATGAGTATCACTAGTCCTAGTTTGCGTGCTGATATTATGCAATATA
TCAAAGAATGTTCAATTTACGACATGCAAGATGGGGTATTGAATGCTGAAGATTTGATGCAGAAAACAGA
TAGTTGGAACAAGCTATTTTCCAATACAAATCCAGCGCGATTTGTAACTCTGGGTATTTTGAAAGGTGCA
CCTGAAACCGTCACATGTGTCGAAGGAGCAACAAGATTAAAGCAACAAGTTAACGATGGTATTGCAGCAG
CAATGCGCTATTACGGAAAAAATGCATTTATAGATTTTAATGAAGCGACTGCTTTATCTATGTATACAAA
TGCTGTTGGAACAAGTTATAGCTGGATACTTGGAGCTAATCAAAGTGCTTCTGATGCTGTTAAACAAAGT
ATGTTTAATAACATTATGAAAGATGCAAATACTGAATTACCGGCACTTATTAATGATCAAACTCGTATAC
AAGAATTAATGGCATCGGCAGGTGCAGCAGCAGCTTCAGAACAAATGAAAGGTGCAGCCGCAGTTTTATC
AAAATTAGCATTTGAAGTCATTCCGATAGTGAGAAATTGGCTAGAAGTTGTTCTATATGCAACATTCCCA
ATAGCGGTCATGTTAATAGTTTTAAAACCGAGTACGGCAGTAAATATTTTATCCGGTTACTTTACAAGCT
TTTTAACGCTTGGCCTTTTTCCTCTAATTTTCGCATTAATTAATCATGCTTCAATGCTATATCTAAGACG
GAAAGCAGAAGCTCTAGATTTTAGTGAGGGCATTCCCTTTACTAAAATGGGGGTATTAGACTCCACAGTC
GTTGATATTCAAACTGTTATTGGATTATTTGTAATTCTAACTATACCTCTAGCTGCATGGATAGCACGAG
GATTTTATGGTGATATAGCTGCAATTGGAAATCAAATAGTTGGGCGCTTTACCTCAGCAGGTTCGTCGAT
CGGCAGTTCAATGGCAATGGGTAATATGACATTGGGTGAAACTAATATTGATTCATCTTCAGTCAACAAC
ACTTCAATGAACAAATATGATAGCAATCTTTCACAAAGCCGAGGTTTAACAACTTTAACAAATGAGTATG
GAACTAGCCATACACTAACCCCATCTGGAGTTATGAATACTCAAAAGCTTGAAGATACAACAGCGCAATC
TCTTCATACAGGCCAATCAATAAGCAGAAGCAACGAAAACCGATATGGACAGAGTACAGATTCTGTATAT
GGCGTTGGTGCGACATATGACACAGCAACTGGTTCAACGAATACAAACTCATATAACAGATCTGAAACAT
ATGGCTTAACGGATGAGAGGGGTGTATCTAATTCTTCAGTAACAGGAGTTGGAAATTCGAAAGGGTATAC
GACTGGAACGAACCAAAACGAATCAGATACTACACATACGGGTGTTTCATTAAGTAAGACAGATTATACG
GCCATGTCTGCCGGAGCAAACGGAAATTTAGGCTTAGGTGGTGGTGCCGGAAGTGGTGGTGGAGGCTCTG
AAGAAAAACGTGTTGCTGGCTCTCCAACTAATCCGGGGAATGTTCAACCTGAATCTAAAGGTGAAGGTGG
TAAAGGTGGTAAAGGTGGTAAAGCTGGAGTTGGTATTCAAGCTGGTGTTGGAGTCTATGCACAAGGTCAG
AAAGGTATTAACTGGAGTGGTACACAAGATGAAGGTCAAAACAGAACTTCAGCAGTTGATGAGTATCGCG
GTGTATCTACCGGAGTTAATTATCGTAATGATCTAGAACATAACAAACATGAAAGTCAAAATGAAACTCA
CACCTCATCAAATGGTCATGAACGTTCGGCCAGCCTTTATGAAAATAATAGTTATGCAGAAAATAGAAAT
GCACAATTAAGTTCAAGAAATGAAGAAGCACGTAGTACTTCTTTTGCAAGCTCTCATTCAATGGAAAGTG
GTTATAACTATGCACAAGATCCTAAGTTTAAAAAAGAAGTTGCTCAACATTTTGGCCTAGACCAGGTTCA
ATTTAGTAATTTAAGTCCGCAGCAACAAACCCAATACATGCAAGATTATTTAGCTAATGAAACTGCACGA
ATTAAAGAGACTCCAAGCACATATGCTGACGGAAAGCCAATTGAATTTAATTTGCCAAGTGACTTTAGAT
CAAATAAAGGCAATGTGGGAAGCCGAAGTGGGATCAGTGCGGATTTTGCTGAAAATTCTAGCAATATTGG
TACTGGAATTAAACAAGTGTCAGTGAATACGGGGCCATCTTCAGCAATTAGTGGTGTGAAAAATAGTCTG
GATGATATTGAAGGTAATATGTCAGTTATTCAGCAGAATCAACATAATAAAACTGAGCACACAAAAGATA
GAAACTTTGAGCTTGAAGAAAAAGTAGGAGAATGGAAACGTAAAGATATTAAGGACACGATTGATTTTGA
TCCTATTGGTCATGCGAAAGAAGCATTTACCGAGTTGAAAGAAAAGGTTATGCCAAAAAATGAAACCCAT
ATAAACAGTAATGGTGCTTCATTTGGCCAGTGGAACAGAAGAGATATTGACCCAAAAAAGTAA
 Primer design