SecReT4
Protein ID: 18466482
T4SS name [ID]Tra_F [578]
Gene symboltrhA
Locus tagHCM1.67
StrainSalmonella enterica subsp. enterica serovar Typhi str. CT18
Repliconplasmid pHCM1 [GenBank: NC_003384] [Browse all T4SS(s) in this replicon]
Location [Strand]44356..44709 [+]
Productpilin precursor
Component typeTraA_F
UniProt IDQ935P5
KEGG IDsty:HCM1.67
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 117 a.a.     [Download]
>gi|18466482|ref|NP_569290.1| pilin precursor [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
MELTLNTNVERGKTNAFAFLKSKHAKVPLFILLVLANCSFAYAGSDDGAFGDIWAYMSEALTGAPGKIIA
CGMLFSVAYFGVVKPNLGLALVSALMMLVMANGEKIISSFLDAGIPL
 
Nucleotide Sequence: 354 bp     [Download]
>gi|18466424|ref|NC_003384.1|:44356-44709 Salmonella enterica subsp. enterica serovar Typhi str. CT18 plasmid pHCM1, complete sequence
ATGGAACTGACATTGAATACTAACGTTGAAAGAGGAAAAACTAACGCTTTTGCATTTTTGAAGTCCAAAC
ATGCAAAAGTGCCTTTGTTTATTCTCTTGGTTTTAGCAAATTGCAGTTTTGCGTACGCGGGTTCCGATGA
TGGAGCCTTCGGCGATATCTGGGCCTACATGAGCGAAGCCTTGACTGGTGCGCCGGGTAAAATCATCGCG
TGCGGCATGTTGTTCTCGGTGGCTTATTTCGGCGTTGTAAAACCTAACCTTGGTTTGGCGCTGGTATCAG
CATTAATGATGCTGGTTATGGCAAACGGTGAAAAAATTATCAGCTCGTTCCTGGATGCTGGTATTCCTCT
GTGA
 Primer design