SecReT4
Protein ID: 18466483
T4SS name [ID]Tra_F [578]
Gene symboltrhL
Locus tagHCM1.69
StrainSalmonella enterica subsp. enterica serovar Typhi str. CT18
Repliconplasmid pHCM1 [GenBank: NC_003384] [Browse all T4SS(s) in this replicon]
Location [Strand]44728..45078 [+]
Productplasmid transfer protein
Component typeTraL_F
UniProt IDQ9RGT2
KEGG IDsty:HCM1.69
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 2e-08, Aligned region: 22..93
Protein Sequence: 116 a.a.     [Download]
>gi|18466483|ref|NP_569291.1| plasmid transfer protein [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
MRGIFPLSGVFMTSQYEIPPHTYRFPYRINMPLLILFWDAKQLGITFVTIASGNIFDFFITSVVVAVVFW
FAYKKAAEEGIRGKLKHKLWWYGFFPGKSVFSSRYFTDPFIRNLYS
 
Nucleotide Sequence: 351 bp     [Download]
>gi|18466424|ref|NC_003384.1|:44728-45078 Salmonella enterica subsp. enterica serovar Typhi str. CT18 plasmid pHCM1, complete sequence
ATGAGGGGGATATTCCCCCTCTCTGGAGTTTTTATGACAAGCCAGTACGAGATACCGCCACATACATATC
GCTTTCCATACAGAATAAATATGCCGTTACTAATTCTATTCTGGGATGCAAAGCAATTGGGTATAACATT
CGTGACTATCGCGAGCGGTAATATTTTTGATTTCTTTATAACTTCGGTAGTTGTGGCGGTGGTGTTCTGG
TTTGCATATAAGAAAGCAGCAGAGGAAGGGATTAGAGGAAAACTAAAACACAAACTGTGGTGGTACGGCT
TTTTTCCTGGAAAATCGGTGTTTAGTAGTCGTTACTTTACCGATCCATTTATCAGAAACCTCTATTCTTG
A
 Primer design