SecReT4
Protein ID: 18466484
T4SS name [ID]Tra_F [578]
Gene symboltrhE
Locus tagHCM1.70
StrainSalmonella enterica subsp. enterica serovar Typhi str. CT18
Repliconplasmid pHCM1 [GenBank: NC_003384] [Browse all T4SS(s) in this replicon]
Location [Strand]45078..45875 [+]
Productpilus assembly protein
Component typeTraE_F
UniProt IDQ9RGT3
KEGG IDsty:HCM1.70
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 8.4e-10, Aligned region: 71..201
Protein Sequence: 265 a.a.     [Download]
>gi|18466484|ref|NP_569292.1| pilus assembly protein [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
MELRMKLLSRLKIPFIKNSSNGDFDNKDETSQKGGEEVKGSFLDSKARFSKEIEGSEIGITYSALIKRDE
KLLRVNTVAMIIIGVLVVKNQFLTDPVTIVLPPNMTEEVKVVGNKASESYKTQWALFFSTLIGNINPTNI
GFVTTTILDALSPDLQAKTRESLQQQTNIMQARGVEQSFKPIDMYYDTKNDMVYVWGTKSTRLINVPDKT
ESSKWTFEWVLGMKNGRPRIAYVNQYSGTPNIKKITINGKEQLATLDNPPPSIGN
 
Nucleotide Sequence: 798 bp     [Download]
>gi|18466424|ref|NC_003384.1|:45078-45875 Salmonella enterica subsp. enterica serovar Typhi str. CT18 plasmid pHCM1, complete sequence
ATGGAGCTAAGAATGAAACTTCTCAGCAGGTTAAAAATTCCATTCATTAAAAATTCCAGTAATGGCGATT
TTGATAACAAGGATGAGACTTCGCAAAAAGGAGGTGAAGAAGTAAAAGGAAGTTTTCTGGATTCAAAAGC
ACGCTTTAGTAAAGAAATTGAAGGTTCTGAAATTGGAATTACATATAGTGCATTGATTAAACGCGACGAA
AAACTCCTACGTGTGAATACAGTTGCAATGATCATTATTGGGGTTCTGGTTGTAAAAAATCAATTTCTCA
CTGATCCTGTGACTATAGTGCTACCGCCAAATATGACGGAAGAAGTCAAAGTTGTTGGAAATAAAGCCTC
AGAATCATATAAAACGCAGTGGGCCTTATTCTTTAGTACTTTGATTGGAAACATAAACCCAACAAACATC
GGTTTTGTTACAACAACTATATTGGATGCGCTTTCTCCGGATTTACAGGCAAAGACCCGGGAATCACTAC
AGCAGCAAACCAATATAATGCAGGCTCGTGGTGTAGAGCAGTCATTTAAGCCGATCGATATGTATTACGA
CACCAAAAATGACATGGTCTATGTCTGGGGAACAAAGTCAACTCGTTTGATTAATGTTCCGGACAAAACT
GAATCATCCAAATGGACGTTTGAATGGGTCCTGGGAATGAAAAATGGACGACCGCGCATAGCCTATGTGA
ACCAGTATTCAGGTACACCAAATATTAAGAAAATTACAATCAACGGCAAAGAACAACTGGCAACACTCGA
TAATCCGCCGCCGTCAATAGGTAACTAA
 Primer design